DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trs33 and Trappc6b

Sequence 1:NP_650450.1 Gene:Trs33 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001100203.1 Gene:Trappc6b RGDID:1309325 Length:158 Species:Rattus norvegicus

Alignment Length:157 Identity:83/158 (53%)
Similarity:112/158 (71%) Gaps:6/158 (4%)


  Fly     1 MSEEILFDCLHAEIVNYCLDSNKEHD------LATLEYIGFTTGYRLIERLTREVSRFKDELETM 59
            |::|.||..||.|:|:....|.::.:      :..||.:||..|..||||.|::.:||||||:.|
  Rat     1 MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIM 65

  Fly    60 KFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRGAL 124
            ||||.|||..::|||:||||||:.|:||:||..||.|.::|.|.:.||||.|::||||||:||.|
  Rat    66 KFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQYLEHASKYLAFTCGLIRGGL 130

  Fly   125 SNLGINSTVTAEVQSIPACKFHIEVNR 151
            |||||.|.|||||.|:|||||.:.:.:
  Rat   131 SNLGIKSIVTAEVSSMPACKFQVMIQK 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 82/152 (54%)
Trappc6bNP_001100203.1 TRAPPC6A_Trs33 3..156 CDD:271347 82/153 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C270200910
eggNOG 1 0.900 E1_KOG3316
Hieranoid 1 1.000
Homologene 1 1.000 H42466
Inparanoid 1 1.050 172 1.000 Inparanoid score I3955
OMA 1 1.010
OrthoDB 1 1.010 D1566836at2759
OrthoFinder 1 1.000 FOG0001816
OrthoInspector 1 1.000 T618656
orthoMCL 1 0.900 OOG5_129131
Panther 1 1.100 LDO PTHR12817
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.