DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trs33 and trs33

Sequence 1:NP_650450.1 Gene:Trs33 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_592831.2 Gene:trs33 PomBaseID:SPAC13G6.05c Length:253 Species:Schizosaccharomyces pombe

Alignment Length:131 Identity:41/132 (31%)
Similarity:75/132 (57%) Gaps:2/132 (2%)


  Fly    24 EHDLATLEYIGFTTGYRLIERLTREVSRFKDELETMKFICTDFWMLIYKKQVDNLRTNNHGMYVV 88
            |.|...||.|||..|.::.|||....:|..:..:.|:|:|.:.|.::::|.:|||:||..|::|:
pombe    45 ESDFQMLESIGFQVGRKITERLLLNRNRITETTDVMRFLCRELWPIVFRKPLDNLKTNRRGIFVL 109

  Fly    89 QDKAFRFLTRIS--PGTKQLEHAPKFVAFTCGLVRGALSNLGINSTVTAEVQSIPACKFHIEVNR 151
            .|..|.:.|:::  .||:..:....:..|..|.:||.:...|.::.|.|:..::|.|.||::.:.
pombe   110 TDTYFYWFTKMTAMTGTEMAQITTPYFYFPSGFIRGVVYTFGYSAQVIAQCPNLPTCIFHVKFSP 174

  Fly   152 N 152
            |
pombe   175 N 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 40/128 (31%)
trs33NP_592831.2 TRAPPC6A_Trs33 12..173 CDD:271347 40/128 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H42466
Inparanoid 1 1.050 93 1.000 Inparanoid score I1695
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001816
OrthoInspector 1 1.000 T1125215
orthoMCL 1 0.900 OOG5_129131
Panther 1 1.100 LDO PTHR12817
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2318
TreeFam 1 0.960
109.950

Return to query results.
Submit another query.