DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trs33 and trpp-6

Sequence 1:NP_650450.1 Gene:Trs33 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_505571.1 Gene:trpp-6 WormBaseID:WBGene00010699 Length:185 Species:Caenorhabditis elegans

Alignment Length:178 Identity:68/179 (38%)
Similarity:97/179 (54%) Gaps:35/179 (20%)


  Fly     7 FDCLHAEIVNYCLDSNKEH------------------DL-----------------ATLEYIGFT 36
            ||.||.||:...|:|.|:.                  |:                 ..||.|||.
 Worm     5 FDILHLEIIRSTLESEKDRCEAKEKFGTIIDNLNGPADIEKYESLVQKAFLHANAETKLESIGFR 69

  Fly    37 TGYRLIERLTREVSRFKDELETMKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISP 101
            .|.:|:|::::|..:...|||.:||||.|||..::.|||||||||:.|:|||||..|..|.....
 Worm    70 VGRQLVEKVSKESPKLVTELEIVKFICKDFWSSVFGKQVDNLRTNHQGVYVVQDGRFTTLRSFPE 134

  Fly   102 GTKQLEHAPKFVAFTCGLVRGALSNLGINSTVTAEVQSIPACKFHIEV 149
            |.:.::.:..|:||.|||:||||:.|.|.:.||..::|:|:.||||:|
 Worm   135 GDQYVKESGYFLAFPCGLLRGALAGLNIRAIVTPTIESVPSVKFHIQV 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 68/179 (38%)
trpp-6NP_505571.1 TRAPPC6A_Trs33 2..183 CDD:271347 68/179 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C270209227
eggNOG 1 0.900 E1_KOG3316
Hieranoid 1 1.000
Homologene 1 1.000 H42466
Inparanoid 1 1.050 124 1.000 Inparanoid score I3254
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1566836at2759
OrthoFinder 1 1.000 FOG0001816
OrthoInspector 1 1.000 T474629
orthoMCL 1 0.900 OOG5_129131
Panther 1 1.100 LDO PTHR12817
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2318
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.