DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs33 and TRAPPC6B

DIOPT Version :9

Sequence 1:NP_650450.1 Gene:Trs33 / 41866 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_016876453.1 Gene:TRAPPC6B / 122553 HGNCID:23066 Length:159 Species:Homo sapiens


Alignment Length:152 Identity:83/152 - (54%)
Similarity:110/152 - (72%) Gaps:6/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEEILFDCLHAEIVNYCLDSNKEHD------LATLEYIGFTTGYRLIERLTREVSRFKDELETM 59
            |::|.||..||.|:|:....|.::.:      :..||.:||..|..||||.|::.:||||||:.|
Human     1 MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIM 65

  Fly    60 KFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRGAL 124
            ||||.|||..::|||:||||||:.|:||:||..||.||::|.|.:.||||.|::||||||:||.|
Human    66 KFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAGKQYLEHASKYLAFTCGLIRGGL 130

  Fly   125 SNLGINSTVTAEVQSIPACKFH 146
            |||||.|.|||||.|:||||.:
Human   131 SNLGIKSIVTAEVSSMPACKLN 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 82/149 (55%)
TRAPPC6BXP_016876453.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147949
Domainoid 1 1.000 167 1.000 Domainoid score I3875
eggNOG 1 0.900 - - E1_KOG3316
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H42466
Inparanoid 1 1.050 174 1.000 Inparanoid score I4071
Isobase 1 0.950 - 0 Normalized mean entropy S1355
OMA 1 1.010 - - QHG59616
OrthoDB 1 1.010 - - D1566836at2759
OrthoFinder 1 1.000 - - FOG0002452
OrthoInspector 1 1.000 - - otm41260
orthoMCL 1 0.900 - - OOG6_102793
Panther 1 1.100 - - O PTHR12817
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2318
SonicParanoid 1 1.000 - - X1632
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.