DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trs33 and TRAPPC6B

Sequence 1:NP_650450.1 Gene:Trs33 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_016876453.1 Gene:TRAPPC6B HGNCID:23066 Length:159 Species:Homo sapiens

Alignment Length:152 Identity:83/153 (54%)
Similarity:110/153 (72%) Gaps:6/153 (4%)


  Fly     1 MSEEILFDCLHAEIVNYCLDSNKEHD------LATLEYIGFTTGYRLIERLTREVSRFKDELETM 59
            |::|.||..||.|:|:....|.::.:      :..||.:||..|..||||.|::.:||||||:.|
Human     1 MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIM 65

  Fly    60 KFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRGAL 124
            ||||.|||..::|||:||||||:.|:||:||..||.||::|.|.:.||||.|::||||||:||.|
Human    66 KFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAGKQYLEHASKYLAFTCGLIRGGL 130

  Fly   125 SNLGINSTVTAEVQSIPACKFH 146
            |||||.|.|||||.|:||||.:
Human   131 SNLGIKSIVTAEVSSMPACKLN 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 82/150 (55%)
TRAPPC6BXP_016876453.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C270202964
eggNOG 1 0.900 E1_KOG3316
Hieranoid 1 1.000
Homologene 1 1.000 H42466
Inparanoid 1 1.050 174 1.000 Inparanoid score I4007
Isobase 1 0.950 0 Normalized mean entropy S1355
OMA 1 1.010
OrthoDB 1 1.010 D1566836at2759
OrthoFinder 1 1.000 FOG0001816
OrthoInspector 1 1.000 T609724
orthoMCL 1 0.900 OOG5_129131
Panther 1 1.100 LDO PTHR12817
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2318
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.