DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31301 and nkrf

Sequence 1:NP_650449.1 Gene:CG31301 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001004499.3 Gene:nkrf ZFINID:ZDB-GENE-030616-73 Length:861 Species:Danio rerio

Alignment Length:400 Identity:98/400 (25%)
Similarity:179/400 (45%) Gaps:61/400 (15%)


  Fly    36 SYKTEYESD--EHWDLRRSFML---AHKDRFEEDRLVCLAQTFVNMEFMGCKY-----PSATMLL 90
            |.|.:|..|  :||   ..|::   ||.       .:|:.........|...|     |::.:.|
Zfish   474 STKGQYVPDRSKHW---TEFVIMENAHD-------AICILNNSAAFNRMKVDYTFDPVPNSNLWL 528

  Fly    91 V-AELSKEIAADFRQKREQRLKRTFVSASDAAEQRAKGRRAPPLPSTSSPEDSSHIKRQCFGGG- 153
            . ..|..|:.|..|..:    |....||::.|.::.:..:|.........:.....::|.|.|| 
Zfish   529 CNVYLQGELVAQARGTK----KSAKHSAAEEAVKKLRMNQAARQQEQQQQQQQQQQQQQQFSGGN 589

  Fly   154 ----DPVDLYQD-----LRFGRLIVYLAGGRACLQNS----CNIANVKYEERVSRDQP---LSDN 202
                :....|..     .:.|.|::        |:||    |.|.:.....:||.:..   |:|:
Zfish   590 YFSEESAGCYSQQSSSVAQLGELVI--------LENSDNAICIINDTAQFNKVSAEYKFTVLADH 646

  Fly   203 TKYAELLVNDEVIATGQGESLKAAKKAAYKQAHLTIQSYCYSIKLNATRDTIKVEKNKDGVN-IK 266
            :...|:.::.:.:|||.|.. |..|..|.::|..|::.....:|.|     ::.|.:.|.:: .:
Zfish   647 SWRCEVYLDGQYVATGLGPK-KTVKHIAAEEALATLRRTQAVVKSN-----LRKEGHADAISRDQ 705

  Fly   267 VTNESADSPCDPKLDPSNKGYRMMRLMGWTGGGLGRLKQGREEPVCYLLKNNRNGLGL-INPKGN 330
            :...|.:.....::...|.|.:::|.||||||||||...|..||:....:..|.|||: ::..|:
Zfish   706 IMCRSGEEAVRQEIKEDNIGNQLLRKMGWTGGGLGREGDGIAEPIKVKEQFTREGLGMDMDRHGS 770

  Fly   331 ---FADYRRLIENYVRSDDIRDMQFEPTFSKEERTTLHQIARQFGLRSASYGSGESRRLLITKKI 392
               ..|...:|.||..|:...|::|....:.|||..:||:::::||||.|||.|..|.|::::::
Zfish   771 QLTKRDIEDIIRNYASSERQDDLRFSTELNNEERRQIHQVSQRYGLRSKSYGQGRQRFLVVSRRV 835

  Fly   393 DYGTILTEVL 402
            ....::.::|
Zfish   836 QKEQLIGQLL 845

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:288780 21/93 (23%)
G_patch 280..323 CDD:197727 19/43 (44%)
R3H_NRF 331..390 CDD:100069 22/59 (37%)
nkrfNP_001004499.3 XTBD 25..105 CDD:288780
DSRM 499..560 CDD:214634 13/65 (20%)
DSRM 621..681 CDD:214634 16/61 (26%)
G-patch 719..762 CDD:295392 19/43 (44%)
R3H_NRF 774..833 CDD:100069 22/59 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114956507
eggNOG 1 0.900 E33208_3BH74
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4172
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1179335at2759
OrthoFinder 1 1.000 FOG0006036
OrthoInspector 1 1.000 T597407
orthoMCL 1 0.900 OOG5_134716
Panther 1 1.100 O PTHR16148
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5408
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.