DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31301 and nkrf

Sequence 1:NP_650449.1 Gene:CG31301 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001039125.1 Gene:nkrf XenbaseID:XB-GENE-877251 Length:791 Species:Xenopus tropicalis

Alignment Length:301 Identity:77/302 (25%)
Similarity:137/302 (45%) Gaps:41/302 (14%)


  Fly   131 PPLPSTSSPEDSSHIKRQCFGGGDPVDLYQDLRFGRLIVYLAG-GRAC-LQNSCNIANVKYE--- 190
            |.||.|...:.::::         |:...:|     :|||... ...| |.|:....|:..:   
 Frog   521 PDLPKTHCVQSTNNV---------PIKELKD-----IIVYANSINPVCTLNNTAQFNNITVDYVF 571

  Fly   191 ERVSRDQPLSDNTKYAELLVNDEVIATGQGESLKAAKKAAYKQAHLTIQSYCYSIKLNATR---D 252
            |||:.|      ....::|:..:.:|...|  ||...|.....|.:.|......:.:|..:   |
 Frog   572 ERVTGD------IWKCKVLMEKQFLAEAMG--LKKTVKHEAAGAAVNILKQTQPVVVNNPKKGPD 628

  Fly   253 TIKVEKNKDGVNIKVTNESADSPCDPKLDPSNKGYRMMRLMGWTGGGLGRLKQGREEPVCYLLKN 317
            ...:.:|      ::...|:|.....::...|.|.:::|.|||.|||||:..:|..||:....:.
 Frog   629 EDAISRN------QIRGWSSDESFKQQIKEDNIGNQLLRKMGWKGGGLGKEGEGISEPISVKEQF 687

  Fly   318 NRNGLGLINPKG--NFADYRRLIENYVRSDDIRDMQFEPTFSKEERTTLHQIARQFGLRSASYGS 380
            :|.||||.:...  |..|..::|.||..|.:..|:.|....|.|||..:|||::::||:|.|:|.
 Frog   688 SREGLGLTSNSHTINKRDIEKIIRNYAASYNQDDLTFSKELSNEERKYIHQISQKYGLKSKSHGH 752

  Fly   381 GESRRLLITKKIDYGTILTEVLLRRNPKFCDRYFVHVPMQK 421
            |..|.|::::|.:...::.:::   .......|.:.:|.||
 Frog   753 GNERFLVVSRKRNKQDLIHQLI---QDGQVGSYALLMPQQK 790

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:288780
G_patch 280..323 CDD:197727 17/43 (40%)
R3H_NRF 331..390 CDD:100069 22/59 (37%)
nkrfNP_001039125.1 XTBD 16..104 CDD:288780
DSRM 456..517 CDD:214634
R3H_NRF 703..762 CDD:100069 22/59 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114957493
eggNOG 1 0.900 E33208_3BH74
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1179335at2759
OrthoFinder 1 1.000 FOG0006036
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.