DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31301 and Cdkn2aip

Sequence 1:NP_650449.1 Gene:CG31301 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_765995.1 Gene:Cdkn2aip MGIID:1918175 Length:563 Species:Mus musculus

Alignment Length:270 Identity:52/271 (19%)
Similarity:100/271 (37%) Gaps:81/271 (30%)


  Fly    32 WDVDSYKTEYESDEHWDLRRSFMLAHKDRF-----------------EEDRLVCLAQTFVNMEFM 79
            | |::.:.|.|:|:||..||.|:|.:....                 :..:||..:..:.|..|:
Mouse    18 W-VETLRCEGETDKHWRHRREFLLRNAGDLVPATDETADAESGARTRQLQQLVSFSMAWANHVFL 81

  Fly    80 GCKYPSATM---LLVAELSKEIAADFRQKREQ---RLKRTFVSAS-------------------- 118
            ||:||...|   |.:||..|...|.....|::   ::|:..:|:|                    
Mouse    82 GCRYPQKVMDKILSMAEGIKVTDAPIHTTRDELVAKVKKRGISSSNEGVEEPSKKRAVEGKNNSS 146

  Fly   119 ---DAAEQRAKGRRAPPLPSTSSPEDSSHIKRQCFGGGDPVDLYQDLRFGRLIVYLAGGRACLQN 180
               |..::.||..|:......|||...|..|.:                       :||.:...:
Mouse   147 VERDHGKKSAKTDRSAAQQENSSPSRGSSTKSE-----------------------SGGTSARSS 188

  Fly   181 SCNIANVKYEERVSRDQPLSDNTKYAELLVNDEVIATGQGESLKAAKKAAYKQAHLTIQSYCYSI 245
            |..    .:::..:.:   .|.:..::...|...:..|.|::|::  :|.:|:...:..|.....
Mouse   189 SSG----SHQDSATSE---GDRSVCSQSSSNSSQVTAGSGKALES--EAPHKRGSASFVSSLLKS 244

  Fly   246 KLNA--TRDT 253
            .:|:  |:.|
Mouse   245 SMNSHMTQST 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:288780 27/107 (25%)
G_patch 280..323 CDD:197727
R3H_NRF 331..390 CDD:100069
Cdkn2aipNP_765995.1 XTBD 19..117 CDD:288780 25/98 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114954851
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16148
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.