DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31301 and CDKN2AIP

Sequence 1:NP_650449.1 Gene:CG31301 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_060102.1 Gene:CDKN2AIP HGNCID:24325 Length:580 Species:Homo sapiens

Alignment Length:436 Identity:78/437 (18%)
Similarity:141/437 (32%) Gaps:130/437 (30%)


  Fly    32 WDVDSYKTEYESDEHWDLRRSFML--------------AHKDRFEE----------DRLVCLAQT 72
            | |::.:.:.|:|:||..||.|:|              |..|...:          .:|:..:..
Human    18 W-VEALRCDGETDKHWRHRRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNRQLQQLISFSMA 81

  Fly    73 FVNMEFMGCKYPSATM---LLVAELSKEIAADFRQKREQRL----KRTFVSASDAAEQRAKGRRA 130
            :.|..|:||:||...|   |.:||..|...|.....|::.:    ||...|:::..|:.:|.|..
Human    82 WANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEPSKKRVI 146

  Fly   131 PPLPSTSSPEDSSHIKRQCFGGGDPVDLYQDLRFGRLIVYLAGGRACL--------QNSCNIANV 187
            .  ...||..:..|.|...             :..|..........|:        .||...:.:
Human   147 E--GKNSSAVEQDHAKTSA-------------KTERASAQQENSSTCIGSAIKSESGNSARSSGI 196

  Fly   188 KYEERVSRDQPLSDNTKYAELLVNDEVIATGQGESLKAAKKAAYKQAHLTIQSYCYSIKLNATRD 252
            ..:...:.|...|.::: :...|:.:|...|.|::.:|.....:..|..                
Human   197 SSQNSSTSDGDRSVSSQ-SSSSVSSQVTTAGSGKASEAEAPDKHGSASF---------------- 244

  Fly   253 TIKVEKNKDGVNIKVT-----NESADSPCDPKLDPSNKGYRM------MRLMGWTGGGLGRL--- 303
               |...|..||..:|     .:.:.||....|:.|:.....      :.|:|.:|.....|   
Human   245 ---VSLLKSSVNSHMTQSTDSRQQSGSPKKSALEGSSASASQSSSEIEVPLLGSSGSSEVELPLL 306

  Fly   304 ---------------KQGREEPVCYLLKNN--RNGLGLINPKGNFADYRRLIENYVRSDDIRDMQ 351
                           |...|..|...:..|  .:|..|:.||.:.:....|:.:           
Human   307 SSKPSSETASSGLTSKTSSEASVSSSVAKNSSSSGTSLLTPKSSSSTNTSLLTS----------- 360

  Fly   352 FEPTFSKEERTTLHQIARQFGLRSASYGSGESRRLLITKKIDYGTI 397
                     ::|....|.....:|:|..||.    |::|.....::
Human   361 ---------KSTSQVAASLLASKSSSQTSGS----LVSKSTSLASV 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:288780 28/115 (24%)
G_patch 280..323 CDD:197727 11/69 (16%)
R3H_NRF 331..390 CDD:100069 8/59 (14%)
CDKN2AIPNP_060102.1 XTBD 19..124 CDD:314776 25/105 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114954925
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16148
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.