powered by:
Protein Alignment CG31301 and cdkn2aipnl
DIOPT Version :9
| Sequence 1: | NP_650449.1 |
Gene: | CG31301 / 41865 |
FlyBaseID: | FBgn0051301 |
Length: | 439 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_012814455.1 |
Gene: | cdkn2aipnl / 549001 |
XenbaseID: | XB-GENE-1003699 |
Length: | 94 |
Species: | Xenopus tropicalis |
| Alignment Length: | 72 |
Identity: | 21/72 - (29%) |
| Similarity: | 39/72 - (54%) |
Gaps: | 4/72 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 VDSYKTEYESDEHWDLRRSFMLAHKDRFEE----DRLVCLAQTFVNMEFMGCKYPSATMLLVAEL 94
|..:::..|||:.|..|..|::.:...||: |||:.|:..:.|..||||:|.:..:..|..:
Frog 6 VGQFQSFSESDKQWQAREEFIIRNLKHFEDESALDRLLALSMVWANHVFMGCRYSNELLEKVFSM 70
Fly 95 SKEIAAD 101
::.|..:
Frog 71 AEGIVVE 77
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
1 |
1.000 |
44 |
1.000 |
Domainoid score |
I12113 |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.