DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31301 and cdkn2aipnl

DIOPT Version :10

Sequence 1:NP_650449.1 Gene:CG31301 / 41865 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_012814455.1 Gene:cdkn2aipnl / 549001 XenbaseID:XB-GENE-1003699 Length:94 Species:Xenopus tropicalis


Alignment Length:72 Identity:21/72 - (29%)
Similarity:39/72 - (54%) Gaps:4/72 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VDSYKTEYESDEHWDLRRSFMLAHKDRFEE----DRLVCLAQTFVNMEFMGCKYPSATMLLVAEL 94
            |..:::..|||:.|..|..|::.:...||:    |||:.|:..:.|..||||:|.:..:..|..:
 Frog     6 VGQFQSFSESDKQWQAREEFIIRNLKHFEDESALDRLLALSMVWANHVFMGCRYSNELLEKVFSM 70

  Fly    95 SKEIAAD 101
            ::.|..:
 Frog    71 AEGIVVE 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:463409 21/72 (29%)
G_patch 280..323 CDD:197727
R3H_NRF 331..390 CDD:100069
cdkn2aipnlXP_012814455.1 XTBD 6..91 CDD:463409 21/72 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.