DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31301 and Cdkn2aipnl

Sequence 1:NP_650449.1 Gene:CG31301 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_084252.1 Gene:Cdkn2aipnl MGIID:1261797 Length:116 Species:Mus musculus

Alignment Length:75 Identity:18/76 (24%)
Similarity:36/76 (47%) Gaps:8/76 (11%)


  Fly    35 DSYKTEYESDEHWDLRRSFMLAHKDRFEE--------DRLVCLAQTFVNMEFMGCKYPSATMLLV 91
            :.:::..||::.|..|..|:|.|...:.:        |:|:.|:..:.|..|:||.|....:..|
Mouse    25 EQFRSYSESEKQWKARMEFILRHLPDYRDPPDGGGRLDQLLSLSMVWANHLFLGCSYNKDLLDKV 89

  Fly    92 AELSKEIAAD 101
            .|::..|..:
Mouse    90 MEMADGIEVE 99

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:288780 18/76 (24%)
G_patch 280..323 CDD:197727
R3H_NRF 331..390 CDD:100069
Cdkn2aipnlNP_084252.1 XTBD 25..113 CDD:314776 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114959307
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16148
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.