DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31301 and Cdkn2aip

Sequence 1:NP_650449.1 Gene:CG31301 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001014022.1 Gene:Cdkn2aip RGDID:1305302 Length:570 Species:Rattus norvegicus

Alignment Length:452 Identity:85/453 (19%)
Similarity:160/453 (35%) Gaps:104/453 (23%)


  Fly    32 WDVDSYKTEYESDEHWDLRRSFMLAHKDRF----EE-------------DRLVCLAQTFVNMEFM 79
            | |::.:.|.|:|:||..||.|:|.:....    ||             .:||..:..:.|..|:
  Rat    18 W-VETLRCEGETDKHWRHRREFLLRNAGDLVPATEETADAESGARSRQLQQLVSFSMAWANHVFL 81

  Fly    80 GCKYPSATM---LLVAELSK-----------EIAADFRQK---------REQRLKRTFVSASDAA 121
            ||:||...|   |.:||..|           |:.|..:::         .|...||:....::::
  Rat    82 GCRYPQKVMDKILSMAEGIKVTDAPIHTTRDELVAKVKKRGISSSNEGVEEPSKKRSIEGKNNSS 146

  Fly   122 EQRAKGRRAPPLPSTSSPEDSSHIKRQCFGGGDPVDLYQDLRFGRLIVYLAGGRACLQNSCNIAN 186
            .:|..|:::.....::..|:||..|                  |......:.|.:...||    .
  Rat   147 VERDHGKKSAKTDRSAQQENSSGSK------------------GSSTKSESSGTSARSNS----G 189

  Fly   187 VKYEERVSRDQPLSDNTKYAELLVN-DEVIATGQGESLKAAKKAAYKQAHLTIQSYCYSIKLNAT 250
            |.::...:.:   .|.:..::...| .:|.:.|.|::.:......:..|.........|:..:.|
  Rat   190 VSHQNSSTSE---GDRSVCSQSSSNSSQVTSAGSGKASEPEAPDKHGSASFVSSLLKSSLNSHVT 251

  Fly   251 RDTIKVE------KNK-DGVNIKVTNESADSPCDPKLDPSNKGYRMMRLMG------WTGGGLGR 302
            :.|...:      ||. :|.::.|:..|::... |.|..|......:.|:.      ....|| .
  Rat   252 KSTDSRQHSGSPRKNALEGSSVSVSQSSSEIEV-PLLGSSGSSEVELPLLSCKSSSETASSGL-T 314

  Fly   303 LKQGREEPVCYLLKNN--RNGLGLINPKGNFADYRRLIENYVRSDDIRDMQFEPTFSKEERTT-- 363
            .|...|..:...:..|  .:|..|:.||.:..:...|......|........:.:.|...::|  
  Rat   315 TKASSEANISSSVSKNSSSSGTSLLMPKSSSTNTSLLTSQVAASLLASKSSSQSSGSVASKSTSL 379

  Fly   364 --LHQIA---------RQFGLRSASYGSGESRRLLITKKIDYGTILTEVLLRRNPKFCDRYF 414
              :.|:|         .|...:|.|..|..|.:....|       ||...:::...|.:|.:
  Rat   380 GSMSQLASKSSSQSSTSQLPSKSTSQSSESSVKFTCRK-------LTNEDIKQKQPFFNRLY 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:288780 30/124 (24%)
G_patch 280..323 CDD:197727 9/51 (18%)
R3H_NRF 331..390 CDD:100069 11/72 (15%)
Cdkn2aipNP_001014022.1 XTBD 19..117 CDD:288780 27/98 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114954951
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16148
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.