DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31301 and Nkrfl

Sequence 1:NP_650449.1 Gene:CG31301 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_233308.7 Gene:Nkrfl RGDID:1563950 Length:578 Species:Rattus norvegicus

Alignment Length:313 Identity:64/314 (20%)
Similarity:113/314 (36%) Gaps:79/314 (25%)


  Fly   117 ASDAAEQRAKGRRAP-PLPSTSSPEDSSHIKRQCF------------------GGGDPVDLYQDL 162
            |..:|.|:|..:.|| |.||...|| |...::|.|                  .|.|.::     
  Rat   140 APSSASQQANCQPAPEPPPSQMYPE-SVVAEKQYFIEKLTATIWKNLSNPEMTSGSDKIN----- 198

  Fly   163 RFGRLIVYLAGGRACLQNSCNIANVKYEERVSRDQPLSDNTKYAELLVND---EV------IATG 218
                 ..|:.  ..|:| :|. .|.:|.....::.|.:|..|..:||.:.   ||      ::||
  Rat   199 -----YTYML--TRCIQ-ACK-TNPEYIYAPLKEIPPADIPKNKKLLTDGYACEVRCQNIYLSTG 254

  Fly   219 QGESLKAAKKAAYKQAHLTIQSYCYSIKLNATRDTIKVEKNK-------DGVNIKVTNESADSPC 276
            ...|...::..|.:.|          :||...|..::|.:.|       |.|..::...|.:.| 
  Rat   255 YAGSKNGSRDRATELA----------VKLLQKRIEVRVVRRKFKHIIGEDLVVCQIGVLSYEFP- 308

  Fly   277 DPKLDPSNKGYRMMRLMGWTGGGLGRLKQGREEPVCYLLKNNRN-GLGLINPKGNFADYRRLIEN 340
             |.|.|...    :.::|....|........:....:::..|.| .:|::|   |.|.:.::...
  Rat   309 -PALKPPED----LVVLGKDASGQPIFNSSAKHWTNFVITENANDAIGILN---NSASFNKMSIE 365

  Fly   341 YVRSDDIRDMQFEPTFSKEERTTL--HQIARQFGLRSASYGSGESRRLLITKK 391
            |       ..:..|..:...|..|  |.:|..:|.:..|..:.....|.:.:|
  Rat   366 Y-------KYEMMPNRTWRCRVFLQDHCLAEGYGTKKTSKHAAADEALKVLQK 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:288780 1/1 (100%)
G_patch 280..323 CDD:197727 6/44 (14%)
R3H_NRF 331..390 CDD:100069 10/61 (16%)
NkrflXP_233308.7 dsrm 349..409 CDD:278464 13/70 (19%)
DSRM 451..512 CDD:214634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114957672
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1179335at2759
OrthoFinder 1 1.000 FOG0006036
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16148
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.