DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31301 and paxt-1

Sequence 1:NP_650449.1 Gene:CG31301 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_492325.2 Gene:paxt-1 WormBaseID:WBGene00011034 Length:335 Species:Caenorhabditis elegans

Alignment Length:355 Identity:77/356 (22%)
Similarity:136/356 (38%) Gaps:97/356 (27%)


  Fly    33 DVDSYKTEYESDEHWDLRRSFMLAHKDRFEEDRLVCLAQTFVNMEFMGCKYPSATMLLVAELSKE 97
            ||::.|..:|||:.|:||::|||||.|.:.:.:|.||:|.|:|:..:||:|....|..:..:...
 Worm     6 DVEAEKKLWESDDAWELRKAFMLAHYDDYPKIQLQCLSQLFINVTLLGCEYSQTLMQKIRTMGAG 70

  Fly    98 IAAD------------FRQKREQRLKRTFVSASDAAEQRAKGRRAPPLPSTSSPEDSSHIKRQCF 150
            |||:            ...|:.|.:|.:.:..:....::.|..::|           |.:.|:.|
 Worm    71 IAANKDRTKTGSYVKASAAKKRQAVKTSDLEGASDESKKVKMEKSP-----------SPVARESF 124

  Fly   151 GGGDPVDLYQDLRFGRLIVYLA------GGRACLQ---NSC------NIANVKYEERVSR----- 195
                      |.|.|:|...||      .|...::   |||      |..|.|.|..:.|     
 Worm   125 ----------DERLGKLKASLAMTPHHLTGEQMMKTATNSCLMKWHVNKINQKIEITIDRYVAFR 179

  Fly   196 ---------DQPLSDNTKYAELL-----VN-------------DEVIATGQGESLKAAKKAAYKQ 233
                     .:..:.||....:|     |:             ||..|......|...|.|....
 Worm   180 HTFSQYCVDPRDCAINTLIESILSCDAAVHEESYEIRFDGVPVDECYAKSVTRRLAKIKSAVSNG 244

  Fly   234 AHLT--IQSYCYSIKLNATRDTIKVEKNKDGVNIKVTNESADSPCDPKLDPSNKGYRMMRLMGWT 296
            ||..  :.:|..::.::..::|.|:|.....:::...:....|             |::.....|
 Worm   245 AHTVKGLTTYLDAVNMSMIQNTQKLEGWSQQLDLVTADLLLSS-------------RVLSSTECT 296

  Fly   297 GGGLGRLKQGREEPVCYLLKNNRNGLGLIN 326
            ...:..:.....|.||.|:.|::  :.:||
 Worm   297 KPAMATIANQMSEDVCQLILNDK--INVIN 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:288780 30/96 (31%)
G_patch 280..323 CDD:197727 7/43 (16%)
R3H_NRF 331..390 CDD:100069
paxt-1NP_492325.2 XTBD 7..91 CDD:288780 28/84 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141052923
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T477076
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16148
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5408
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.