DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31301 and Nkrf

Sequence 1:NP_650449.1 Gene:CG31301 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_003754887.2 Gene:Nkrf RGDID:6500424 Length:783 Species:Rattus norvegicus

Alignment Length:374 Identity:91/375 (24%)
Similarity:151/375 (40%) Gaps:98/375 (26%)


  Fly    37 YKTEYESDEHWDLRRSFMLAHKDRFEEDRLVCLAQTFVNMEFMGCKYPSATMLLVAELSKEIAAD 101
            ||.|...:..|.. |.|:..|          |||:.:      |.|          :.||..|||
  Rat   462 YKYEMMPNRTWRC-RVFLQDH----------CLAEGY------GTK----------KTSKHAAAD 499

  Fly   102 FRQKREQRLKRTFVSASDAAEQRAKGRRAPPLPSTSSPEDSSHIKRQCFGGGDPVDLYQDLRFGR 166
            ...|..|:.:.|:.|...:                           ||..|..|....:......
  Rat   500 EALKVLQKTQPTYSSVKSS---------------------------QCHSGSSPKGSGKKKDIKD 537

  Fly   167 LIVYLAGGRACLQNS----CNIANVKYEERVSRDQPLSDNTKY---AELLVNDEVIATGQGESLK 224
            |:||        :||    |.:.:.....|::.:......|..   .::::..||||...|.. |
  Rat   538 LVVY--------ENSSNPVCTLNDTAQFNRMTVEYVYERMTGLRWKCKVILESEVIAEAVGVK-K 593

  Fly   225 AAKKAAYKQAHLTIQSYCYSIKLNATRDTIK--VEKNKDGVNIKVTNESADSPCDPKLDPSNKGY 287
            :.|..|..:|..|::....::..|..:.|::  :.:|      ::...||:.....::...|.|.
  Rat   594 SVKYEAAGEAVKTLKKTQPTVINNLKKGTVEDVISRN------EIQGRSAEEAYKQQIKEDNIGN 652

  Fly   288 RMMRLMGWTGGGLGRLKQGREEPVCYLLKNNRNGLGLINPKGNFADYRRLIENYVRSDDIRD--M 350
            :::|.|||||||||:..:|..||:....::.|.||||        |..|:  |.:...||..  |
  Rat   653 QLLRKMGWTGGGLGKSGEGIREPISVKEQHKREGLGL--------DVERV--NKIAKRDIEQSLM 707

  Fly   351 QF-------EPT-FSKEERTTLHQIARQFGLRSASYGSGESRRLLITKK 391
            ::       .|| .:.:||..:||||:::||:|.|:|.|..|.|::.:|
  Rat   708 KYXSSLTXIRPTELTNDERKQIHQIAQKYGLKSKSHGVGHDRYLVVGRK 756

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:288780 21/81 (26%)
G_patch 280..323 CDD:197727 18/43 (42%)
R3H_NRF 331..390 CDD:100069 22/69 (32%)
NkrfXP_003754887.2 XTBD 40..>107 CDD:288780
dsrm 445..505 CDD:278464 18/70 (26%)
DSRM 547..608 CDD:214634 13/62 (21%)
G-patch 645..688 CDD:295392 18/43 (42%)
R3H 699..755 CDD:294210 19/56 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114957664
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006036
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16148
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.