DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31301 and cdkn2aip

Sequence 1:NP_650449.1 Gene:CG31301 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_002934305.1 Gene:cdkn2aip XenbaseID:XB-GENE-984876 Length:411 Species:Xenopus tropicalis

Alignment Length:424 Identity:85/425 (20%)
Similarity:147/425 (35%) Gaps:135/425 (32%)


  Fly    32 WDVDSYKTEYESDEHWDLRRSFMLA------------------HKDRFEEDRLVCLAQTFVNMEF 78
            | ::..:.|.|||:.|..||.|:|.                  ||   |.|||:..:..:.|..|
 Frog    20 W-LERVRGECESDKWWQHRREFILRNLRDVCGEGEIPPLPETNHK---ELDRLLAYSMAWANHVF 80

  Fly    79 MGCKYPSATM---LLVAELSKEIAADFRQKREQ---RLKRTFVSASDAAEQRAKGRRAPPLPSTS 137
            .||:||...|   |.:||..|...|.....|::   ::|:..:|:|:      :|....|.....
 Frog    81 TGCRYPLPVMEKVLKMAENIKVTDAPTHTTRDELVAKVKKRGISSSN------EGVEEEPCKKQK 139

  Fly   138 SPED-----SSHIKRQCFGGGDPVDLYQDLRFGRLIVYLAGGRACLQNSCNIANVKYEERVSRDQ 197
            |.||     :|::..:......|.|..:.          :.|:.|..|..:.:..|.|...:..|
 Frog   140 STEDHGARKTSNVNDRVENRNQPSDTMES----------SSGKICDGNVPSTSLNKREVHSNAAQ 194

  Fly   198 PLSDNTKYAELLVNDEVI-ATGQGESLKAAKKAAYKQAHLTIQSYCYSIKLNATRDTIKVEKNKD 261
            ....||::.|...|...: .|....||...|:|.||                  .|..:..|:. 
 Frog   195 RTDTNTEFYEKSGNRRPLPVTKAKSSLNLPKEAGYK------------------HDAAQERKSH- 240

  Fly   262 GVNIKVTNESADSPCDPKLDPSNKG--------YRMMRLMGW---TGGGLGRLKQGREEPVCYLL 315
              ::|..::|:|:...|....:::.        .|:.:.:.|   :.||...             
 Frog   241 --SVKGPSQSSDNAFKPTRRFTSEDTKERQPFFNRLYKTVAWKLVSAGGFNA------------- 290

  Fly   316 KNNRNGLGLINPKGNFADYRRLIEN--------YVRSDDIRDMQFEPTFSKEERTTLHQIARQFG 372
              |.|...|:|         ..||:        :|...|:.|:       .:.:|:...|..:..
 Frog   291 --NLNHEELLN---------SCIESLKATLDIAFVPLKDLADL-------PQNKTSQENIVCELR 337

  Fly   373 LRSASYGSG--------------ESRRLLITKKI 392
            .:|...|.|              |:.:|.:.||:
 Frog   338 CKSVYLGMGCGKTKETAKAVASREAVKLFLKKKV 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:288780 30/108 (28%)
G_patch 280..323 CDD:197727 6/54 (11%)
R3H_NRF 331..390 CDD:100069 12/81 (15%)
cdkn2aipXP_002934305.1 XTBD 21..117 CDD:288780 28/99 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114954789
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.