DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Surf4 and Surf1

Sequence 1:NP_477222.1 Gene:Surf4 FlyBaseID:FBgn0019925 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_524758.1 Gene:Surf1 FlyBaseID:FBgn0029117 Length:300 Species:Drosophila melanogaster

Alignment Length:42 Identity:11/43 (26%)
Similarity:16/43 (37%) Gaps:4/43 (9%)


  Fly   146 VPSMGENKPKNFMQLAGRILLAFMFITLIRFELSVWQVIQDI 187
            :|:......:....|...:||    |....|.|..|||.:.|
  Fly    49 IPNQAAKDKEKIAPLGWFLLL----IPATTFGLGCWQVKRKI 86

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Surf4NP_477222.1 SURF4 5..270 CDD:111019 11/43 (26%)
Surf1NP_524758.1 SURF1 74..289 CDD:119401 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113235336
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23427
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.