DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6218 and AT1G30540

Sequence 1:NP_001262598.1 Gene:CG6218 FlyBaseID:FBgn0038321 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_564358.1 Gene:AT1G30540 AraportID:AT1G30540 Length:351 Species:Arabidopsis thaliana

Alignment Length:300 Identity:76/300 (25%)
Similarity:127/300 (42%) Gaps:43/300 (14%)


  Fly     6 GVEGGATHSRLVIC--------------DESGQSVGATSGLGTNHWGIGIPECARRIADMVERAK 56
            |::|||| |.:.:|              ...|::|...    ||...:|.......:..::..|.
plant    34 GLDGGAT-STVCVCVPFFSFGERFPDPLPILGRAVAGC----TNRNSVGETAARDSLEQVISEAL 93

  Fly    57 EEAGIPKETPLTSLGLSLSGCEQEATNRELEQELRTTFPGLAQNY-------AVSSDTMGSMYTA 114
            .::|..| :.:..:.|.:||....:...::|..:|..||...:.|       |::|.|||.::  
plant    94 VQSGFDK-SDVRGVCLGVSGVNHPSDQEKIENWIRDMFPSHVKVYVQNDAIVALASGTMGKLH-- 155

  Fly   115 SSIGGMVLISGTGSNCLLRNPDGSTSNCGGWGNFLGDEGSAWYISYRAVKVVFDHMDNFEQSAAP 179
                |.|||:|||......:.||..:...|.|..|||.||.:.|:.:|:..|....|    ...|
plant   156 ----GCVLIAGTGCIAYGFDEDGKEARASGGGPILGDWGSGYGIAAQALTAVIRAHD----GRGP 212

  Fly   180 VEKTWSLIKEHFSLETRLDMLPHCYAKFDKPFFANLCKKLSQNAENGDELARSLFREAGVHLARM 244
            .....|.|.:...|.:..:::...||.......|.|..::...||.|||::..:..:|...||..
plant   213 QTMLTSTILKALGLSSPDELIGWTYADPSWARIAALVPQVVSCAEAGDEISDKILVDAAEDLALS 277

  Fly   245 ILALLPNVHQDLVKSGDLS--VVCVGSVWSS---WDLLQE 279
            :.|::..:.. ..|.|..|  ||.||.|.::   ||:.:|
plant   278 VKAVVQRLGL-CGKDGTASFPVVMVGGVLNANQKWDIGKE 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6218NP_001262598.1 NBD_sugar-kinase_HSP70_actin 1..285 CDD:302596 76/300 (25%)
AT1G30540NP_564358.1 BcrAD_BadFG 33..345 CDD:280110 76/300 (25%)
NagC 85..345 CDD:224851 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I2446
OMA 1 1.010
OrthoDB 1 1.010 D1572762at2759
OrthoInspector 1 1.000 T193531
orthoMCL 1 0.900 OOG5_130335
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
76.880

Return to query results.
Submit another query.