DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6218 and Nagk

Sequence 1:NP_001262598.1 Gene:CG6218 FlyBaseID:FBgn0038321 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001334244.1 Gene:Nagk MGIID:1860418 Length:361 Species:Mus musculus

Alignment Length:334 Identity:151/335 (45%)
Similarity:214/335 (64%) Gaps:11/335 (3%)


  Fly    10 GATHSRLVICDESGQSVGATSGLGTNHWGIGIPECARRIADMVERAKEEAGIPKETPLTSLGLSL 74
            |.|.|::::..|.||.:....||.||||.||..:|..||.:||:|||::||:....||.||||||
Mouse    29 GGTRSKVLLLSEDGQILAEADGLSTNHWLIGTDQCVERINEMVDRAKQKAGVDPLVPLRSLGLSL 93

  Fly    75 SGCEQEATNRELEQELRTTFPGLAQNYAVSSDTMGSMYTASSIGGMVLISGTGSNCLLRNPDGST 139
            ||.|||...|.|.:|||..||.|::||.:::|..||:.||:..||:||||||||||.|.|||||.
Mouse    94 SGGEQEDAVRLLIEELRHRFPNLSENYLITTDAAGSIATATPDGGIVLISGTGSNCRLINPDGSE 158

  Fly   140 SNCGGWGNFLGDEGSAWYISYRAVKVVFDHMDNFEQSAAPVEKTWSLIKEHFSLETRLDMLPHCY 204
            |.|||||:.:||||||::|:::|||:|||.:||.|.:...:......:.::|.:..||.:|.|.|
Mouse   159 SGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGHVKQAMFDYFQVPDRLGILTHLY 223

  Fly   205 AKFDKPFFANLCKKLSQNAENGDELARSLFREAGVHLARMILALLPNVHQDLVKSGDLS--VVCV 267
            ..|||..||..|:|:::.|..||.|:|.:||:||..|.|.::|:||.:...|.: |:|.  ::||
Mouse   224 RDFDKCKFAGFCQKIAEGAHQGDPLSRYIFRKAGEMLGRHVVAVLPEIDPVLFQ-GELGLPILCV 287

  Fly   268 GSVWSSWDLLQEAFISEL-------AKTTIDFDLKLVRITKSSAYGACYLGADSADFDLPRNYAD 325
            ||||.||:||:|.|:..|       |:.:.. ...|:::..|||.|...|||....:.||.:|:.
Mouse   288 GSVWKSWELLKEGFLLALTLGREQQAQNSFS-SFTLMKLRHSSALGGASLGARHIGYHLPMDYSI 351

  Fly   326 NVTVLYTYT 334
            |....|:||
Mouse   352 NAIAFYSYT 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6218NP_001262598.1 NBD_sugar-kinase_HSP70_actin 1..285 CDD:302596 134/277 (48%)
NagkNP_001334244.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C165241579
eggNOG 1 0.900 E1_COG2971
Hieranoid 1 1.000
Homologene 1 1.000 H9720
Inparanoid 1 1.050 302 1.000 Inparanoid score I2637
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005852
OrthoInspector 1 1.000 T1084105
orthoMCL 1 0.900 OOG5_130335
Panther 1 1.100 LDO PTHR12862
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3943
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.