DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6218 and NAGK

Sequence 1:NP_001262598.1 Gene:CG6218 FlyBaseID:FBgn0038321 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_060037.4 Gene:NAGK HGNCID:17174 Length:344 Species:Homo sapiens

Alignment Length:339 Identity:154/340 (45%)
Similarity:213/340 (63%) Gaps:9/340 (3%)


  Fly     4 FGGVEGGATHSRLVICDESGQSVGATSGLGTNHWGIGIPECARRIADMVERAKEEAGIPKETPLT 68
            :||||||.|.|.:::..|.|:.:....||.||||.||..:|..||.:||.|||.:||:....||.
Human     5 YGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLR 69

  Fly    69 SLGLSLSGCEQEATNRELEQELRTTFPGLAQNYAVSSDTMGSMYTASSIGGMVLISGTGSNCLLR 133
            ||||||||.:||...|.|.:|||..||.|:::|.:::|..||:.||:..||:||||||||||.|.
Human    70 SLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLI 134

  Fly   134 NPDGSTSNCGGWGNFLGDEGSAWYISYRAVKVVFDHMDNFEQSAAPVEKTWSLIKEHFSLETRLD 198
            |||||.|.|||||:.:||||||::|:::|||:|||.:||.|.:...:......:..:|.:..||.
Human   135 NPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLG 199

  Fly   199 MLPHCYAKFDKPFFANLCKKLSQNAENGDELARSLFREAGVHLARMILALLPNVHQDLV--KSGD 261
            :|.|.|..|||..||..|:|:::.|:.||.|:|.:||:||..|.|.|:|:||.:...|.  |.| 
Human   200 ILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIG- 263

  Fly   262 LSVVCVGSVWSSWDLLQEAFI------SELAKTTIDFDLKLVRITKSSAYGACYLGADSADFDLP 320
            |.::||||||.||:||:|.|:      .|:..........|:::..|||.|...|||......||
Human   264 LPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLP 328

  Fly   321 RNYADNVTVLYTYT 334
            .:|:.|....|:||
Human   329 MDYSANAIAFYSYT 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6218NP_001262598.1 NBD_sugar-kinase_HSP70_actin 1..285 CDD:302596 139/289 (48%)
NAGKNP_060037.4 NBD_sugar-kinase_HSP70_actin 1..279 CDD:327376 135/275 (49%)
Substrate binding. {ECO:0000244|PDB:2CH5, ECO:0000269|PubMed:17010375} 129..130 1/1 (100%)
Substrate binding. {ECO:0000244|PDB:2CH5, ECO:0000269|PubMed:17010375} 145..147 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C165240498
eggNOG 1 0.900 E1_COG2971
Hieranoid 1 1.000
Homologene 1 1.000 H9720
Inparanoid 1 1.050 295 1.000 Inparanoid score I2717
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1572762at2759
OrthoFinder 1 1.000 FOG0005852
OrthoInspector 1 1.000 T1074012
orthoMCL 1 0.900 OOG5_130335
Panther 1 1.100 LDO PTHR12862
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3943
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.