DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6218 and Nagk

Sequence 1:NP_001262598.1 Gene:CG6218 FlyBaseID:FBgn0038321 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001032857.1 Gene:Nagk RGDID:1305057 Length:343 Species:Rattus norvegicus

Alignment Length:340 Identity:155/341 (45%)
Similarity:217/341 (64%) Gaps:11/341 (3%)


  Fly     4 FGGVEGGATHSRLVICDESGQSVGATSGLGTNHWGIGIPECARRIADMVERAKEEAGIPKETPLT 68
            :||||||.|.|::::..|.||.:....||.||||.||...|..||.:||:|||.:||:....||.
  Rat     5 YGGVEGGGTRSKVLLLSEDGQILAEADGLSTNHWLIGTGTCVERINEMVDRAKRKAGVDPLVPLR 69

  Fly    69 SLGLSLSGCEQEATNRELEQELRTTFPGLAQNYAVSSDTMGSMYTASSIGGMVLISGTGSNCLLR 133
            ||||||||.|||...|.|.:|||..||.|:::|.:::|..||:.||:..||:||||||||||.|.
  Rat    70 SLGLSLSGGEQEDAVRLLMEELRDRFPYLSESYFITTDAAGSIATATPDGGIVLISGTGSNCRLI 134

  Fly   134 NPDGSTSNCGGWGNFLGDEGSAWYISYRAVKVVFDHMDNFEQSAAPVEKTWSLIKEHFSLETRLD 198
            |||||.|.|||||:.:||||||::|:::|||:|||.:||.|.:...:......:..:|.:..||.
  Rat   135 NPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGHVKQAMFNYFQVPDRLG 199

  Fly   199 MLPHCYAKFDKPFFANLCKKLSQNAENGDELARSLFREAGVHLARMILALLPNVHQDLVKSGDLS 263
            :|.|.|..|||..||..|:|:::.|:.||.|:|.:||:||..|.|.::|:||.:...|.: |:|.
  Rat   200 ILTHLYRDFDKSKFAGFCQKIAEGAQQGDPLSRFIFRKAGEMLGRHVVAVLPEIDPVLFQ-GELG 263

  Fly   264 --VVCVGSVWSSWDLLQEAFISEL-------AKTTIDFDLKLVRITKSSAYGACYLGADSADFDL 319
              ::||||||.||:||:|.|:..|       |:.:.. ...|:::..|||.|...|||......|
  Rat   264 LPILCVGSVWKSWELLKEGFLLALTQGREQQAQNSFS-SFTLMKLRHSSALGGASLGARHIGHHL 327

  Fly   320 PRNYADNVTVLYTYT 334
            |.:|:.|....|:||
  Rat   328 PMDYSVNAIAFYSYT 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6218NP_001262598.1 NBD_sugar-kinase_HSP70_actin 1..285 CDD:302596 138/283 (49%)
NagkNP_001032857.1 NBD_sugar-kinase_HSP70_actin 1..279 CDD:302596 135/275 (49%)
Substrate binding. {ECO:0000250|UniProtKB:Q9UJ70} 129..130 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:Q9UJ70} 145..147 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C165241185
eggNOG 1 0.900 E1_COG2971
Hieranoid 1 1.000
Homologene 1 1.000 H9720
Inparanoid 1 1.050 297 1.000 Inparanoid score I2597
OMA 1 1.010
OrthoDB 1 1.010 D1572762at2759
OrthoFinder 1 1.000 FOG0005852
OrthoInspector 1 1.000 T1087655
orthoMCL 1 0.900 OOG5_130335
Panther 1 1.100 LDO PTHR12862
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.