DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6218 and W06B4.1

Sequence 1:NP_001262598.1 Gene:CG6218 FlyBaseID:FBgn0038321 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_494790.2 Gene:W06B4.1 WormBaseID:WBGene00021056 Length:408 Species:Caenorhabditis elegans

Alignment Length:382 Identity:70/383 (18%)
Similarity:144/383 (38%) Gaps:69/383 (18%)


  Fly     3 YFGGVEGGATHSRLVICDESGQSVGATSGLGTNHW----GIGIPECARRIADMVERAKEEAGIPK 63
            ::.||||....:|:|:.|.:          .|.:|    |..:.....|:|.....:..||.:.|
 Worm    36 FYCGVEGNLACTRIVVIDSA----------NTRYWRTVVGTDLHYFKPRVASETIASGVEAAMRK 90

  Fly    64 ET---------PLTSLGLSLSGCEQEATNRELEQELRTTFPGLA------QNYAVSS--DTMGSM 111
            .|         .:..:.:..:..::.....:|....|..:..:|      :::.|.|  |.:...
 Worm    91 ATGKDNWREKGVIRRVVVLFAQTDRGDKVDDLVTFFRNKYVSVAPEKRICEDFHVMSEIDAVAPA 155

  Fly   112 YTASSIGGMVLISGTGSNCLLRNPDGSTSNCGGWGNFLGDEGSAW------YISYRAVKVVFDHM 170
            :......|:.|.:|..:.|.|...||:..........:|..|:.|      .:....|:...::|
 Worm   156 HFQKGEEGIALQAGVDAFCRLVLKDGTMKKPDITPGMIGHGGAYWCGRTSFQMFVNDVERGTENM 220

  Fly   171 DNFEQSAAPVEKTWSLIKEHFSLETRLDMLPH---CYAKFDKPFFANLCKKLSQN---------- 222
            .:....::..:|...:.|..||::...|:|..   |::.:.|...|...:||:::          
 Worm   221 MSRGNKSSVTDKIKDVFKTVFSMKNDRDLLQMNEICFSNYYKHRLALFTEKLARHNMIGDVDTTK 285

  Fly   223 AENGDE--------------LARSLFREAGVHLARMILALLPNVHQDLVKSGDLSVVCVGSVWSS 273
            .|.|:|              :...:|..||:.|..:::.:| ..:....|...|.::..|.::.|
 Worm   286 QEEGEEEEQNEQVEEYEQLPVIAEVFHNAGITLGNLVVNVL-RQYPPTEKEKTLKILLFGRMFDS 349

  Fly   274 WDLLQEAFISELAKTTIDFDLKLVRITKSSAYGACYLGADSADFDLPRN---YADNV 327
            :..|...|:..::.|..: .::|.|..:.||..|....|...:.:|..|   :.|.|
 Worm   350 YKNLMSGFLDSISDTGFE-RVELYRKKEVSAVTAAIHAASLDNIELGMNEMEFIDRV 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6218NP_001262598.1 NBD_sugar-kinase_HSP70_actin 1..285 CDD:302596 59/336 (18%)
W06B4.1NP_494790.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C165235109
eggNOG 1 0.900 E1_COG2971
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12862
Phylome 1 0.910 0.917 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.