DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6218 and W06B4.2

Sequence 1:NP_001262598.1 Gene:CG6218 FlyBaseID:FBgn0038321 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_494789.1 Gene:W06B4.2 WormBaseID:WBGene00021057 Length:521 Species:Caenorhabditis elegans

Alignment Length:319 Identity:107/320 (33%)
Similarity:168/320 (53%) Gaps:25/320 (8%)


  Fly     4 FGGVEGGATHSRLVICDESGQSVGATSGLGTNHWGIGIPECARRIADMVERA--KEEAGIPKETP 66
            :.|:|||||.|:|||.|........:|..|||.:........:||||.:...  ||:..|..   
 Worm   196 YAGIEGGATGSKLVIIDADTNQRYTSSTEGTNFFLTDHTIVCKRIADWILEVFEKEKLDIKN--- 257

  Fly    67 LTSLGLSLSGCEQEATNRELEQELRTTFPGLAQNYAVSSDTMGSMYT--ASSIGGMVLISGTGSN 129
            |.:|||.|||.|.|..|::.....|.....:.:|:.::||.:.::..  .....|:|||:||||:
 Worm   258 LKALGLGLSGAEDEEFNKKFVDYFRQNHGNVTENFYLTSDAVMTLLANFPGEENGIVLIAGTGSS 322

  Fly   130 CLLRNPDGSTSNCGGWGNFLGDEGSAWYISYRAVKVVFDHMDNFEQS-AAPVEKTWSLIKEHFSL 193
            |.|:..|||....||||:.:||.|||::|:..|::::||..|.||:: ...|.|  .|:.:|:::
 Worm   323 CRLKIRDGSVKGAGGWGHQIGDGGSAFWIARTAIQMLFDAEDGFEENFNTDVIK--QLLFKHYNI 385

  Fly   194 ETRLDMLPHCYAKFDKPFFANLCKKLSQNAENGDELARSLFREAGVHL---ARMILALLPNVHQD 255
            ..:..||.:.|:||:|...|:....|::..:  |......||.||..|   .|.:...|.|..:.
 Worm   386 TDKTRMLDYLYSKFEKHKIADFTVSLAERTD--DAAVAEAFRRAGDVLGKHVRTVAKYLTNEDRK 448

  Fly   256 LVKSGDLSVVCVGSVWSSWDLLQEAFISELAKTTIDFDLKLVRI--TKSSAYGACYLGA 312
            :     ||:|.:|.|:.|||.||:.|::.|:.:.|:   |:|..  :.|.|.||..|.|
 Worm   449 V-----LSIVQIGGVFQSWDALQQGFVASLSGSGIE---KIVMYEPSDSPAVGAAVLAA 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6218NP_001262598.1 NBD_sugar-kinase_HSP70_actin 1..285 CDD:302596 97/289 (34%)
W06B4.2NP_494789.1 AdoMet_MTases 10..155 CDD:302624
NBD_sugar-kinase_HSP70_actin 195..500 CDD:302596 107/320 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C165235130
eggNOG 1 0.900 E1_COG2971
Hieranoid 1 1.000
Homologene 1 1.000 H9720
Inparanoid 1 1.050 151 1.000 Inparanoid score I2930
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005852
OrthoInspector 1 1.000 T477272
orthoMCL 1 0.900 OOG5_130335
Panther 1 1.100 O PTHR12862
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3943
TreeFam 1 0.960
1211.780

Return to query results.
Submit another query.