DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6218 and nagk

Sequence 1:NP_001262598.1 Gene:CG6218 FlyBaseID:FBgn0038321 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_002938443.1 Gene:nagk XenbaseID:XB-GENE-978864 Length:344 Species:Xenopus tropicalis

Alignment Length:338 Identity:153/339 (45%)
Similarity:214/339 (63%) Gaps:7/339 (2%)


  Fly     4 FGGVEGGATHSRLVICDESGQSVGATSGLGTNHWGIGIPECARRIADMVERAKEEAGIPKETPLT 68
            :||||||.|||::::..|.|:.:..|.|..||||.||:.:|...|..||..||::||:..:.||.
 Frog     5 YGGVEGGGTHSKVILISEDGRILTETEGPCTNHWLIGVDKCLAAINAMVTEAKQKAGLDPQIPLR 69

  Fly    69 SLGLSLSGCEQEATNRELEQELRTTFPGLAQNYAVSSDTMGSMYTASSIGGMVLISGTGSNCLLR 133
            |||:||||.||:.....|.:|||..||.|:.:|.:|:||:|:|.||:.:||:||||||||||.|.
 Frog    70 SLGMSLSGGEQKEAIAHLIEELRVRFPQLSDSYHISNDTIGAMATATELGGVVLISGTGSNCKLV 134

  Fly   134 NPDGSTSNCGGWGNFLGDEGSAWYISYRAVKVVFDHMDNFEQSAAPVEKTWSLIKEHFSLETRLD 198
            ||||:...|||||:.:||||||::||:||:|:|||.:|||......:..|...:..:|.:..||.
 Frog   135 NPDGTVVGCGGWGHMMGDEGSAYWISHRAMKMVFDAVDNFVAPPHDISYTQQAMYSYFQVSDRLG 199

  Fly   199 MLPHCYAKFDKPFFANLCKKLSQNAENGDELARSLFREAGVHLARMILALLPNVHQDLVKSG-DL 262
            :|.|.|..|:|...|..|.||::.|..||.|..|:||.||..|||.:.|:||.....|.:.. .|
 Frog   200 ILTHLYRSFEKSKVAGFCVKLAEGARLGDPLCCSVFRSAGEILARHVAAVLPKADTVLFEGALGL 264

  Fly   263 SVVCVGSVWSSWDLLQEAFISELA-----KTTIDFD-LKLVRITKSSAYGACYLGADSADFDLPR 321
            .:|||||||:||:|:::.|:..||     .....|. ..|:::.:|||.|...|||.:....||.
 Frog   265 PIVCVGSVWNSWELMKDGFLEVLADRHGGPAGSSFSRFSLLKLKQSSAMGGASLGARNIGHVLPL 329

  Fly   322 NYADNVTVLYTYT 334
            |||.||.:.||::
 Frog   330 NYAANVDIFYTHS 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6218NP_001262598.1 NBD_sugar-kinase_HSP70_actin 1..285 CDD:302596 133/282 (47%)
nagkXP_002938443.1 NagC 1..325 CDD:224851 144/320 (45%)
NBD_sugar-kinase_HSP70_actin 7..275 CDD:302596 128/268 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C165241420
eggNOG 1 0.900 E1_COG2971
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H9720
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1572762at2759
OrthoFinder 1 1.000 FOG0005852
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.