DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6218 and nagk

Sequence 1:NP_001262598.1 Gene:CG6218 FlyBaseID:FBgn0038321 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_005166603.1 Gene:nagk ZFINID:ZDB-GENE-070928-19 Length:344 Species:Danio rerio

Alignment Length:338 Identity:147/339 (43%)
Similarity:217/339 (64%) Gaps:8/339 (2%)


  Fly     4 FGGVEGGATHSRLVICDESGQSVGATSGLGTNHWGIGIPECARRIADMVERAKEEAGIPKETPLT 68
            :||||||.|||:.|:....|..:..|.|..||||.:|:..|...|.:||:.||.:||:..:||:.
Zfish     5 YGGVEGGGTHSKAVLVSAEGDILAETDGPCTNHWLVGVDNCISGINEMVQSAKIKAGLDPDTPIC 69

  Fly    69 SLGLSLSGCEQEATNRELEQELRTTFPGLAQNYAVSSDTMGSMYTASSIGGMVLISGTGSNCLLR 133
            |||:||||.||:|..::|..::...:|.|:|:|.:::|.:|:|.|||..||:|:||||||||.|.
Zfish    70 SLGMSLSGGEQKAAIQKLIDDMHERYPKLSQSYFITTDAIGAMATASDYGGIVVISGTGSNCKLV 134

  Fly   134 NPDGSTSNCGGWGNFLGDEGSAWYISYRAVKVVFDHMDNFEQSAAPVEKTWSLIKEHFSLETRLD 198
            ||||:...|||||:.:||||||::||:.|||.|||..||...|...:......::::|.:...:.
Zfish   135 NPDGTQIGCGGWGHMMGDEGSAYWISHLAVKTVFDARDNLVTSPHDITYVKKAMEDYFQVSDLMG 199

  Fly   199 MLPHCYAKFDKPFFANLCKKLSQNAENGDELARSLFREAGVHLARMILALLPNVHQDLVKSGDLS 263
            ||||.|..|.|..||..|:||::....||.|.:.:|||||..||:.|:|:||.|||||.: |:|.
Zfish   200 MLPHLYRNFQKSHFAGFCRKLAEGGNAGDALCQHVFREAGKVLAQHIVAVLPEVHQDLFR-GELG 263

  Fly   264 --VVCVGSVWSSWDLLQEAFISELAKT-TIDFD----LKLVRITKSSAYGACYLGADSADFDLPR 321
              |:||||||.||:|::..|...|::. :.|:.    ..|:.:.:|||.|...:||.:....||.
Zfish   264 LPVLCVGSVWRSWELMKSGFTQVLSQAQSHDYSHFRKYSLLTLRQSSALGGAKMGAKNIGTTLPL 328

  Fly   322 NYADNVTVLYTYT 334
            :|:.||.:.:::|
Zfish   329 DYSANVNMFFSHT 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6218NP_001262598.1 NBD_sugar-kinase_HSP70_actin 1..285 CDD:302596 132/283 (47%)
nagkXP_005166603.1 NBD_sugar-kinase_HSP70_actin 7..287 CDD:302596 131/281 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C165240911
eggNOG 1 0.900 E1_COG2971
Hieranoid 1 1.000
Homologene 1 1.000 H9720
Inparanoid 1 1.050 269 1.000 Inparanoid score I2940
OMA 1 1.010
OrthoDB 1 1.010 D1572762at2759
OrthoFinder 1 1.000 FOG0005852
OrthoInspector 1 1.000 T1053291
orthoMCL 1 0.900 OOG5_130335
Panther 1 1.100 LDO PTHR12862
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3943
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.