DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and DIA4

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_011875.1 Gene:DIA4 SGDID:S000001053 Length:446 Species:Saccharomyces cerevisiae

Alignment Length:407 Identity:147/408 (36%)
Similarity:218/408 (53%) Gaps:32/408 (8%)


  Fly    14 LLLRRQRSHDAKAVEAPIHRPVPTSAQLDELERNVVVRHHKNNVPLIRSLIQEL--DAGDQH-KL 75
            |.|..:|..:.|.::..|     ...|:........::..|..:....:.::.|  ...||: |.
Yeast    52 LQLLGERYQNIKEIDKVI-----ADIQIQRKSIEAQIKKDKTKITEYSAALKALKEQYNDQNSKS 111

  Fly    76 RQLQAEL----EQLPNATHPRLRDYGEEPRELAQYVHRQLTP-----QSRLKEFSELARALNLYR 131
            .:|:.::    :.|||...|.:      |.:..| :.:.:.|     .|..:...::....|:..
Yeast   112 SELKKKILETCKSLPNTLDPTV------PLDAPQ-IEQWINPLKTHKTSEAQAHVDIMLKKNMLD 169

  Fly   132 MDHLGNYTGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLISVPDILPKEVIESCGM--RTEGE 194
            :....|.||...|||....|.||||::.|||:...|:||.....|.|..||:|::||.  |....
Yeast   170 LQTASNVTGMSWYYLLNDGARLEQALVAYALKKANENGFSSCVPPSITKKELIDACGFNPRDMNN 234

  Fly   195 RTQVYKL-DTGECLSGTSEMALAGFFANKL--LSEDQLPLKVTAVSRCYRAETSGL-QEEKGIYR 255
            ..|:|.| ||...|..|:|:.|||..|||:  |:..:...|:..||||||||.... ::.||:||
Yeast   235 ERQIYALQDTNLGLVATAEIPLAGLGANKVLELNSGECSKKLVGVSRCYRAEAGARGKDTKGLYR 299

  Fly   256 VHQFNKVEMFAICTEEQSEAELEEFKNIEVDLFRRLGLNFRLLDMPPCELGAPAYQKYDIEAWMP 320
            ||:|.|||:|.....|.|...|||.|..::.:...||:..::|:||..:||.||::|||||||||
Yeast   300 VHEFTKVELFCWSKPETSAKVLEEIKQFQISVVEELGIPAKVLNMPSNDLGNPAFKKYDIEAWMP 364

  Fly   321 GRQMWGEISSCSNCTDYQARRLGIRYRRSADGQILHAHTINGTATAIPRLLIALLES-YQKEDG- 383
            ||..:|||||.|||||:|:|||..:||....|::.:.||:||||.||||:::||:|: |....| 
Yeast   365 GRGKFGEISSASNCTDFQSRRLNTKYRDDNTGKLEYVHTLNGTAMAIPRVIVALVENFYDPSTGK 429

  Fly   384 IEIPAVLRPFMDNQELI 400
            |.:|..||.||:.|..|
Yeast   430 ISVPECLREFMNGQRYI 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 140/362 (39%)
class_II_aaRS-like_core 100..394 CDD:294192 128/307 (42%)
DIA4NP_011875.1 serS 1..440 CDD:273066 144/400 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C254564158
eggNOG 1 0.900 E1_COG0172
Hieranoid 1 1.000
Homologene 1 1.000 H6073
Inparanoid 1 1.050 229 1.000 Inparanoid score I729
Isobase 1 0.950 0 Normalized mean entropy S479
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004395
OrthoInspector 1 1.000 T1136327
orthoMCL 1 0.900 OOG5_126677
Panther 1 1.100 LDO PTHR11778
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1456
TreeFam 1 0.960
1312.730

Return to query results.
Submit another query.