DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and SES1

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_010306.1 Gene:SES1 SGDID:S000002430 Length:462 Species:Saccharomyces cerevisiae

Alignment Length:427 Identity:120/428 (28%)
Similarity:203/428 (47%) Gaps:44/428 (10%)


  Fly    12 PLLLLRRQRSHDAKA-----VEAPIHRPVPTSAQLDELERNV------VVRHHKNNVPLIRSLIQ 65
            |.|:.:.|::.:|..     :.:.....|.|..:||||.:..      :....||.......|.:
Yeast    15 PELIRQSQKARNASVEIVDEIISDYKDWVKTRFELDELNKKFNKLQKDIGLKFKNKEDASGLLAE 79

  Fly    66 ---------ELDAGDQHKLRQLQAELEQLPNATHPRL---RDYGEEPRELAQYVHRQ-------- 110
                     ||...:|.:.:.|:.::.|:.|..||.:   .|  ||..||.:....:        
Yeast    80 KEKLTQQKKELTEKEQQEDKDLKKKVFQVGNIVHPSVVVSND--EENNELVRTWKPEDLEAVGPI 142

  Fly   111 --LTPQSRLKEFSELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLI 173
              :|.:.......|:...|:.|..|......||:.|:.......|.||:|.|.||.:...|:..:
Yeast   143 ASVTGKPASLSHHEILLRLDGYDPDRGVKICGHRGYFFRNYGVFLNQALINYGLQFLAAKGYIPL 207

  Fly   174 SVPDILPKEVIESCGMRTEGERTQVYKLDTGE---CLSGTSEMALAGFFANKLLS--EDQLPLKV 233
            ..|.::.||::......:|.:. ::||:..||   .|..|||..::.:.:.:...  ::|||:..
Yeast   208 QAPVMMNKELMSKTAQLSEFDE-ELYKVIDGEDEKYLIATSEQPISAYHSGEWFEKPQEQLPIHY 271

  Fly   234 TAVSRCYRAET-SGLQEEKGIYRVHQFNKVEMFAICTEEQSEAELEEFKNIEVDLFRRLGLNFRL 297
            ...|.|:|.|. |..::..|::|||.|.|:|.|.|...|:|..|.|:..:...:.::.|.|.:|:
Yeast   272 VGYSSCFRREAGSHGKDAWGVFRVHAFEKIEQFVITEPEKSWEEFEKMISYSEEFYKSLKLPYRI 336

  Fly   298 LDMPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIR--YRRSADGQILHAHTI 360
            :.:...||...|.:|||:|||.|.::.:.|:.|||||||||:|.|.||  .::..|.:..:.|.:
Yeast   337 VGIVSGELNNAAAKKYDLEAWFPYQKEYKELVSCSNCTDYQSRNLEIRCGIKKMGDREKKYVHCL 401

  Fly   361 NGTATAIPRLLIALLESYQKEDGIEIPAVLRPFMDNQ 397
            |.|..|..|.|..:||:||.|||:.:|.|||.::..:
Yeast   402 NSTLAATQRALCCILENYQTEDGLVVPEVLRKYIPGE 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 108/369 (29%)
class_II_aaRS-like_core 100..394 CDD:294192 96/312 (31%)
SES1NP_010306.1 SerS 1..449 CDD:333239 120/428 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0172
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S479
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126677
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.750

Return to query results.
Submit another query.