DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and AT5G27470

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_198099.1 Gene:AT5G27470 AraportID:AT5G27470 Length:451 Species:Arabidopsis thaliana

Alignment Length:410 Identity:125/411 (30%)
Similarity:203/411 (49%) Gaps:24/411 (6%)


  Fly    18 RQRSHDAKAVEAPIHRPVPTSAQL---DELERNVVVRHHKNNVPLIRSLIQELDAGDQHKLRQLQ 79
            |||..:..:.....::.....|||   .|....::.:..||...   |..:|.:..:.:  ..|:
plant    43 RQRQFEVDSFRKEFNKLNKQVAQLKIKKEDASEIIQQTEKNKQD---STAKEAEVREAY--AALK 102

  Fly    80 AELEQLPNATHPRLRDYGEEPRELAQYV---HRQLTPQSRLKEFSELARALNLYRMDHLGNYTGH 141
            |:|||:.|..|..:....:|...|...:   .|..||..:||...:|...|.:..........|.
plant   103 AKLEQVGNLVHDSVPVDKDEANNLVIKLWGEKRFSTPGLKLKNHVDLVELLGIADTKRGAEIAGA 167

  Fly   142 KSYYLTGQLATLEQAIIQYALQAVTEHGFKLISVPDILPKEVIESCGMRTEGERTQVYKLDTGE- 205
            :.::|.|....|.||:|.:.|..:.:.||..:..|..:.|:|:..|....:.:. ::||: ||| 
plant   168 RGFFLKGDGLMLNQALINFGLTFLKKRGFTGLQPPFFMRKDVMAKCAQLAQFDE-ELYKV-TGEG 230

  Fly   206 ---CLSGTSEMALAGFFANKLLSEDQLPLKVTAVSRCYRAET-SGLQEEKGIYRVHQFNKVEMFA 266
               .|..|:|..|..:..::.:...:|||:....|.|:|.|. |..::..||:|||||.|:|.|.
plant   231 DDKYLIATAEQPLCAYHIDEWIHPTELPLRYAGYSSCFRKEAGSHGRDTLGIFRVHQFEKIEQFC 295

  Fly   267 IC--TEEQSEAELEEFKNIEVDLFRRLGLNFRLLDMPPCELGAPAYQKYDIEAWMPGRQMWGEIS 329
            |.  .|..|...|:|......|.::.|.|.::::.:....|...|.:|||:|||.|..:.:.|:.
plant   296 ITGPNENASWEMLDEMMKNSEDFYQALKLPYQIVSIVSGALNDAAAKKYDLEAWFPSSETFRELV 360

  Fly   330 SCSNCTDYQARRLGIRY--RRSADGQILHAHTINGTATAIPRLLIALLESYQKEDGIEIPAVLRP 392
            |||||||||||||.|||  ::|.:....:.|.:|.|.||..|.:..:||:||:|||::||.||:|
plant   361 SCSNCTDYQARRLEIRYGQKKSNEQTKQYVHMLNSTLTATERTICCILENYQREDGVDIPEVLQP 425

  Fly   393 FMDNQELITRNKR--IPETK 410
            ||..:..:....:  :.:||
plant   426 FMGGETFLPFKAKPVVADTK 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 114/356 (32%)
class_II_aaRS-like_core 100..394 CDD:294192 103/306 (34%)
AT5G27470NP_198099.1 PLN02678 1..451 CDD:215364 125/411 (30%)
Seryl_tRNA_N 2..112 CDD:280549 17/74 (23%)
SerRS_core 124..427 CDD:238393 103/305 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D726296at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126677
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.