DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and Sars2

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_076126.2 Gene:Sars2 MGIID:1919234 Length:518 Species:Mus musculus

Alignment Length:425 Identity:161/426 (38%)
Similarity:240/426 (56%) Gaps:33/426 (8%)


  Fly     3 LPTNSQLWRPLLLLRRQ-RSHDA-KAVEAPIHRPVPTSAQLDELERNVVVRHHKNNVPLIRSLIQ 65
            ||.....|:.|..||.| ||.:| |...|...|.:..:...|:::::...:..:.....||..:.
Mouse    86 LPAIISTWQELRQLREQIRSLEAEKEAVAEAVRALLANQDSDQVQKDPQYQGLRARGREIRKQLT 150

  Fly    66 ELDAGDQHKLRQLQAELEQLPNATHPR-----------LRDYGEEPRELAQYVHRQLTPQSRLKE 119
            .|...:.....||..:..:|||.|||.           :|..||:|....|       |:..|  
Mouse   151 PLYPQETQLEEQLYQQALRLPNQTHPDTPVGDESQARVVRVVGEKPAFSFQ-------PRGHL-- 206

  Fly   120 FSELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLISVPDILPKEVI 184
              |:...|::.|...|.:.:||:||||.|..|.|:..::.:.|..:...||..::|||:|...|.
Mouse   207 --EIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTLSKLVSRGFTPMTVPDLLRGAVF 269

  Fly   185 ESCGMRTEGERTQVYKLDTGEC----LSGTSEMALAGFFANKLLSEDQLPLKVTAVSRCYRAETS 245
            |.|||......:|:|.:|....    |:||:|:.|||:|.:..::...||:::...|.||||||.
Mouse   270 EGCGMTPNANPSQIYNIDPSRFEDLNLAGTAEVGLAGYFMDHSVAFRDLPVRMVCASTCYRAETD 334

  Fly   246 GLQEEKGIYRVHQFNKVEMFAICTE--EQSEAELEEFKNIEVDLFRRLGLNFRLLDMPPCELGAP 308
            ..:|..|:||||.|.|||||.:...  |||...|:||.:::|::...|||:||:||||..|||.|
Mouse   335 TGKEPWGLYRVHHFTKVEMFGVTGPGLEQSSQLLDEFLSLQVEILTELGLHFRVLDMPTQELGLP 399

  Fly   309 AYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIRYRRSADGQILHAHTINGTATAIPRLLIA 373
            ||:|:|||||||||..:||::|.|||||:|:|||.|.: .:..|::..|||:|.||.|:||:|||
Mouse   400 AYRKFDIEAWMPGRGRYGEVTSASNCTDFQSRRLYIMF-ETETGELQFAHTVNATACAVPRVLIA 463

  Fly   374 LLESYQKEDG-IEIPAVLRPFMDNQELITRNKRIP 407
            ||||.|::|| :.:||.|:|:: ..:.||....:|
Mouse   464 LLESNQQKDGSVLVPAALQPYL-GTDRITAPTHVP 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 146/362 (40%)
class_II_aaRS-like_core 100..394 CDD:294192 130/301 (43%)
Sars2NP_076126.2 PRK05431 67..493 CDD:235461 160/420 (38%)
Seryl_tRNA_N 67..172 CDD:299883 21/86 (24%)
SerRS_core 185..485 CDD:238393 133/312 (43%)
L-serine binding. {ECO:0000250|UniProtKB:Q9N0F3} 299..301 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C254549509
eggNOG 1 0.900 E1_COG0172
Hieranoid 1 1.000
Homologene 1 1.000 H6073
Inparanoid 1 1.050 267 1.000 Inparanoid score I3009
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D495094at33208
OrthoFinder 1 1.000 FOG0004395
OrthoInspector 1 1.000 T1084099
orthoMCL 1 0.900 OOG5_126677
Panther 1 1.100 LDO PTHR11778
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1456
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.