DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and SARS

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001317598.1 Gene:SARS HGNCID:10537 Length:536 Species:Homo sapiens

Alignment Length:421 Identity:122/422 (29%)
Similarity:201/422 (48%) Gaps:51/422 (12%)


  Fly    35 VPTSA-QLDELERNVVVRHHKNNVPLIRSLIQELDAGDQHKLRQLQAE----LEQLPNATHPRLR 94
            ||.:. ..|:|..:.:.....:.:..:|.||.|.......:..:|:||    |.::.|..||.:.
Human    80 VPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVP 144

  Fly    95 DYGEEPRELAQYVHRQLTPQSRLKEFS--ELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQAI 157
            ...:|  ::...|.|.....:..|::|  :|...::.:..:......|.:.|:|.|.|..||||:
Human   145 ISNDE--DVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQAL 207

  Fly   158 IQYALQAVTEHGFKLISVPDILPKEVIESCGMRTEGERTQVYKL---------DTG---ECLSGT 210
            |||||:.:...|:..|..|..:.|||::.....::.:. ::||:         |..   :.|..|
Human   208 IQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDE-ELYKVIGKGSEKSDDNSYDEKYLIAT 271

  Fly   211 SEMALAGFFANKLLSEDQLPLKVTAVSRCYRAET-SGLQEEKGIYRVHQFNKVEMFAICT--EEQ 272
            ||..:|....::.|..:.||:|...:|.|:|.|. |..::.:||:|||||.|:|.|...:  :.:
Human   272 SEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNK 336

  Fly   273 SEAELEEFKNIEVDLFRRLGLNFRLLDMPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDY 337
            |....||......:.::.||:.:.::::....|...|.:|.|:|||.||...:.|:.||||||||
Human   337 SWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDY 401

  Fly   338 QARRLGIRYRRS------------------------ADGQILHAHTINGTATAIPRLLIALLESY 378
            |||||.|||.::                        :..::...|.:|.|..|..|.:.|:||:|
Human   402 QARRLRIRYGQTKKMMDKRKNNLHLSTQNKLEASLFSPKKVEFVHMLNATMCATTRTICAILENY 466

  Fly   379 QKEDGIEIPAVLRPFMDN--QELITRNKRIP 407
            |.|.||.:|..|:.||..  ||||...|..|
Human   467 QTEKGITVPEKLKEFMPPGLQELIPFVKPAP 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 116/391 (30%)
class_II_aaRS-like_core 100..394 CDD:294192 99/335 (30%)
SARSNP_001317598.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0172
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S479
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D495094at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126677
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.