DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and SARS2

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001139373.1 Gene:SARS2 HGNCID:17697 Length:520 Species:Homo sapiens

Alignment Length:434 Identity:160/435 (37%)
Similarity:244/435 (56%) Gaps:62/435 (14%)


  Fly    20 RSHDAKAVEAPIHRPVPTSAQLDELERNV-VVRHHKNNV-PLIRSLIQELDAGDQHKLR------ 76
            ||.|..|:       :.|..:|.:|:..: .:...|..| ..:|:|:...|:|:..::|      
Human    82 RSADLPAI-------ISTWQELRQLQEQIRSLEEEKAAVTEAVRALLANQDSGEVQQVRLDPGAG 139

  Fly    77 ------------QL----QAELEQ--------LPNATHPRLRDYGEEPRELAQYVHR-------Q 110
                        ||    :|:||:        |||.|||.: ..|:|.:  |:.:|.       .
Human   140 SIFGPTFLPFPGQLSLLVEAQLEEQFYLQALKLPNQTHPDV-PVGDESQ--ARVLHMVGDKPVFS 201

  Fly   111 LTPQSRLKEFSELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLISV 175
            ..|:..|    |:...|::.|...|.:.:||:||||.|..|.|:..::.:....:...||..::|
Human   202 FQPRGHL----EIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTFNKLLRRGFTPMTV 262

  Fly   176 PDILPKEVIESCGMRTEGERTQVYKLDTGEC----LSGTSEMALAGFFANKLLSEDQLPLKVTAV 236
            ||:|...|.|.|||......:|:|.:|....    |:||:|:.|||:|.:..::...||:::...
Human   263 PDLLRGAVFEGCGMTPNANPSQIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCS 327

  Fly   237 SRCYRAETSGLQEEKGIYRVHQFNKVEMFAICTE--EQSEAELEEFKNIEVDLFRRLGLNFRLLD 299
            |.||||||:..||.:|:||||.|.|||||.:...  |||...||||.::::::...|||:||:||
Human   328 STCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGLEQSSQLLEEFLSLQMEILTELGLHFRVLD 392

  Fly   300 MPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIRYRRSADGQILHAHTINGTA 364
            ||..|||.|||:|:|||||||||..:||::|.|||||:|:|||.|.::..| |::..|||:|.||
Human   393 MPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEA-GELQFAHTVNATA 456

  Fly   365 TAIPRLLIALLESYQKEDG-IEIPAVLRPFMDNQELITRNKRIP 407
            .|:||||||||||.|::|| :.:|..|:.:: ..:.||....:|
Human   457 CAVPRLLIALLESNQQKDGSVLVPPALQSYL-GTDRITAPTHVP 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 150/388 (39%)
class_II_aaRS-like_core 100..394 CDD:294192 130/308 (42%)
SARS2NP_001139373.1 PRK05431 58..495 CDD:235461 159/429 (37%)
SerRS_core 187..487 CDD:238393 130/307 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0172
Hieranoid 1 1.000
Homologene 1 1.000 H6073
Inparanoid 1 1.050 262 1.000 Inparanoid score I3047
Isobase 1 0.950 0 Normalized mean entropy S479
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D495094at33208
OrthoFinder 1 1.000 FOG0004395
OrthoInspector 1 1.000 T609725
orthoMCL 1 0.900 OOG5_126677
Panther 1 1.100 LDO PTHR11778
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1456
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.