DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and sars

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001003882.1 Gene:sars ZFINID:ZDB-GENE-040831-1 Length:515 Species:Danio rerio

Alignment Length:410 Identity:123/411 (30%)
Similarity:208/411 (51%) Gaps:45/411 (11%)


  Fly    35 VPTSAQ-LDELERNVVVRHHKNNVPLIRSLIQE-LDAGDQHKLRQLQAE----LEQLPNATHPRL 93
            :|..|| |:.|....:.......:..:|.|:.| :...|..:|: |:||    |.::.|..||.:
Zfish    80 LPEEAQNLEALTAETLSPLTVTQIKKVRVLVDEAVQKTDSDRLK-LEAERFEYLREIGNLLHPSV 143

  Fly    94 RDYGEEPRELAQYVHRQLTPQSRLKEFS--ELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQA 156
            ....:|..:  ..|.|.....:..|::|  :|...::.|..:......|.:.|:|.|.|..||||
Zfish   144 PISNDEDAD--NKVERTWGDCTVQKKYSHVDLVVMVDGYEGEKGAIVAGSRGYFLKGPLVFLEQA 206

  Fly   157 IIQYALQAVTEHGFKLISVPDILPKEVIESCGMRTEGERTQVYKL--------DTG----ECLSG 209
            :|.|||:.:....:.|:..|..:.|||::.....::.:. ::||:        |..    :.|..
Zfish   207 LINYALRILYSKNYNLLYTPFFMRKEVMQEVAQLSQFDE-ELYKVIGKGSEKSDDNTVDEKYLIA 270

  Fly   210 TSEMALAGFFANKLLSEDQLPLKVTAVSRCYRAET-SGLQEEKGIYRVHQFNKVEMFAICT--EE 271
            |||..:|.|..::.|..::||::...:|.|:|.|. |..::.:||:|||||.|:|.|...:  :.
Zfish   271 TSEQPIAAFLRDEWLKPEELPIRYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYASPHDG 335

  Fly   272 QSEAELEEFKNIEVDLFRRLGLNFRLLDMPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTD 336
            :|....:|........::.||:.:|::::....|...|.:|.|:|||.||.|.:.|:.|||||||
Zfish   336 KSWEMFDEMIGTAESFYQTLGIPYRIVNIVSGALNHAASKKLDLEAWFPGSQAFRELVSCSNCTD 400

  Fly   337 YQARRLGIRY---RRSADGQILHAHTINGTATAIPRLLIALLESYQKEDGIEIPAVLRPFMDNQE 398
            ||||||.|||   ::..| :....|.:|.|..|..|::.|:||::|.|:||.:|..|:.||    
Zfish   401 YQARRLRIRYGQTKKMMD-KAEFVHMLNATMCATTRVICAILENFQTEEGIIVPEPLKAFM---- 460

  Fly   399 LITRNKRIPE--TKLVKFIK 416
                    |.  |:::||:|
Zfish   461 --------PPGLTEIIKFVK 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 113/369 (31%)
class_II_aaRS-like_core 100..394 CDD:294192 99/314 (32%)
sarsNP_001003882.1 SerS 3..475 CDD:333239 123/411 (30%)
Interaction with tRNA. {ECO:0000250|UniProtKB:P49591} 9..61
Nuclear localization signal. {ECO:0000250|UniProtKB:P49591} 482..494
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0172
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D495094at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126677
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.