DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and sars

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_998852.1 Gene:sars XenbaseID:XB-GENE-969040 Length:511 Species:Xenopus tropicalis

Alignment Length:415 Identity:128/416 (31%)
Similarity:207/416 (50%) Gaps:43/416 (10%)


  Fly    35 VPTSAQLDELERNVVVRHHKNNVPLIRSLIQELDAGDQHKLRQLQAE----LEQLPNATHPRLRD 95
            :|.:.|||:|...|:.......:..:|.||.|..|....:..:|:||    |.::.|..||.:..
 Frog    80 LPENIQLDQLTAEVLSALSVTQIKRLRVLIDEAIAATDTERIKLEAERFESLREIGNLLHPTVPI 144

  Fly    96 YGEEPRELAQYVHRQLTPQSRLKEFS--ELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQAII 158
            ..:|..:  ..|.|........|.:|  :|...::.:..:......|.:.|:|.|.|..||||:|
 Frog   145 SNDEDND--NKVERTWGDCEVRKRYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGPLVFLEQALI 207

  Fly   159 QYALQAVTEHGFKLISVPDILPKEVIESCGMRTEGERTQVYKL---------DTG---ECLSGTS 211
            |:||..:.|..:..|..|..:.|||::.....::.:. ::||:         |..   :.|..||
 Frog   208 QFALHTLAEKQYTPIYTPFFMRKEVMQEVAQLSQFDE-ELYKVIGKGSEKSDDNSIDEKYLIATS 271

  Fly   212 EMALAGFFANKLLSEDQLPLKVTAVSRCYRAET-SGLQEEKGIYRVHQFNKVEMFAICTEEQSEA 275
            |..:|....::.|..::|||:...:|.|:|.|. |..::.:||:|||||.|:|.|...:...:::
 Frog   272 EQPIAALHRDEWLKPEELPLRYAGISTCFRQEVGSHGRDTRGIFRVHQFEKIEQFIYASPNDNKS 336

  Fly   276 -EL-EEFKNIEVDLFRRLGLNFRLLDMPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQ 338
             || ||........:::||:.:|::::....|...|.:|.|:|||.||...:.|:.|||||||||
 Frog   337 WELFEEMIMTAESFYQKLGIPYRIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQ 401

  Fly   339 ARRLGIRY---RRSADGQILHAHTINGTATAIPRLLIALLESYQKEDGIEIPAVLRPFMD----- 395
            ||||.|||   ::..| ::...|.:|.|..|..|.:.|:||:||.|:||.||..||.||.     
 Frog   402 ARRLRIRYGQTKKMMD-KVEFVHMLNATMCATTRAICAILENYQTEEGIIIPEKLRDFMPPGLNY 465

  Fly   396 ----------NQELITRNKRIPETK 410
                      :|||..:.|:..:.|
 Frog   466 IIKFVKPAPIDQELTKKQKKQQQEK 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 120/383 (31%)
class_II_aaRS-like_core 100..394 CDD:294192 103/314 (33%)
sarsNP_998852.1 SerS 3..474 CDD:333239 123/398 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0172
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D495094at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.