DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and sars2

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_957473.1 Gene:sars2 ZFINID:ZDB-GENE-040426-1616 Length:510 Species:Danio rerio

Alignment Length:471 Identity:167/472 (35%)
Similarity:256/472 (54%) Gaps:66/472 (14%)


  Fly     4 PTNSQLW---------RPLLLLRRQRSHDAKAVEAPIH------RP--VP-----------TSAQ 40
            |..|.|:         :|.|.:||. ..:|:|:.|.:.      ||  ||           ...:
Zfish    39 PVRSSLYEHVLDGYSHKPELDMRRV-CEEAEALTAELEDRRGDLRPADVPLIISVWKNLQKVQEE 102

  Fly    41 LDELE----------RNVVVRHHKNNVPLIRSLIQELDAGD--QHKLRQL---QAELE------- 83
            :..||          |.:|.:|.|:.:..:.......:.|.  :.||.||   :.|||       
Zfish   103 ISHLEGRKQVVSSTVRELVGKHDKSTLSSLEEYGHAREEGRAIREKLNQLYLQEKELEKEHYCRA 167

  Fly    84 -QLPNATHPRLRDYGEEPRELAQYVHRQLTPQSRLKEFSELARALNLYRMDHLGNYTGHKSYYLT 147
             :|||.|||.:....|....:.:.|..:.....:.|...::..:|::.|...|.:.:||:||||.
Zfish   168 LRLPNRTHPSVPIGDESQARVVEVVGEKREFDFKPKGHLQIGESLDIIRQRRLSHVSGHRSYYLR 232

  Fly   148 GQLATLEQAIIQYALQAVTEHGFKLISVPDILPKEVIESCGMRTEGERTQVYKLDTGEC----LS 208
            |..|.|:.|:..:|:..:.:.||..:.|||||...|.|.|||:...:::|||.|:....    |:
Zfish   233 GAGAQLQFALQNFAMDLLQKRGFIPMVVPDILKSVVFEGCGMQPHAQKSQVYSLNPKRSPDLNLA 297

  Fly   209 GTSEMALAGFFANKLLSEDQLPLKVTAVSRCYRAETSGLQEEKGIYRVHQFNKVEMFAIC---TE 270
            ||.::.:||:|.:..::...||::....|.||||||...:|..|:||||.|.|:||..:.   |.
Zfish   298 GTGKVGVAGYFMDHAVNLKDLPVRTVCSSTCYRAETDTGRETWGLYRVHHFTKIEMLGVSANETG 362

  Fly   271 EQSEAELEEFKNIEVDLFRRLGLNFRLLDMPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCT 335
            |:|...|::|..::.::|..|.|::|:||||..|||.|||:|:|||||||||..:|||||.||||
Zfish   363 EESSQLLDQFVTLQKEIFSSLKLHYRVLDMPTQELGPPAYRKFDIEAWMPGRGSFGEISSASNCT 427

  Fly   336 DYQARRLGIRYRRSADGQILHAHTINGTATAIPRLLIALLESYQKEDG-IEIPAVLRPFMDNQEL 399
            |||:|||.||| ...||::.:|||:|.||.||||.:||:||:||.:.| :::|.||:.:: ..|:
Zfish   428 DYQSRRLDIRY-EGEDGKLQYAHTVNATACAIPRTIIAILETYQTKKGTVQVPEVLQQYI-GMEV 490

  Fly   400 ITRNKRIPETKLVKFI 415
            |.:.|..|    :|:|
Zfish   491 IEKPKYTP----IKYI 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 143/365 (39%)
class_II_aaRS-like_core 100..394 CDD:294192 126/302 (42%)
sars2NP_957473.1 PRK05431 58..494 CDD:235461 159/439 (36%)
Seryl_tRNA_N 58..172 CDD:299883 26/115 (23%)
SerRS_core 185..486 CDD:238393 126/302 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C254549282
eggNOG 1 0.900 E1_COG0172
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6073
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D495094at33208
OrthoFinder 1 1.000 FOG0004395
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126677
Panther 1 1.100 LDO PTHR11778
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.