DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and Sars2

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001099710.1 Gene:Sars2 RGDID:1309456 Length:518 Species:Rattus norvegicus

Alignment Length:434 Identity:164/435 (38%)
Similarity:238/435 (55%) Gaps:51/435 (12%)


  Fly     3 LPTNSQLWRPLLLLRRQ-------RSHDAKAVEAPIHRPVPTSAQLDELERNVVVRHHKNNVPLI 60
            ||.....|:.|..||.|       :...|:||.|.:.:......|.|...:.:..|..:     |
  Rat    86 LPAIISTWQELRQLREQIQSLEAEKEAVAEAVRALLAKQDSNQVQKDPQYQGLRTRGRE-----I 145

  Fly    61 RSLIQELDAGDQHKLRQLQAELEQ----LPNATHPR-----------LRDYGEEPRELAQYVHRQ 110
            |..:..|    ..:..||:.|..|    |||.|||.           ||..|::|....|     
  Rat   146 RKQLTPL----YPRETQLEEEFYQQALRLPNQTHPDTPVGDESQARVLRVVGDKPAFSFQ----- 201

  Fly   111 LTPQSRLKEFSELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLISV 175
              |:..|    |:...|::.|...|.:.:||:||||.|..|.|:..::.:.|..:...||..::|
  Rat   202 --PRGHL----EIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTLSKLVSRGFTPMTV 260

  Fly   176 PDILPKEVIESCGMRTEGERTQVYKLDTGEC----LSGTSEMALAGFFANKLLSEDQLPLKVTAV 236
            ||:|...|.|.|||......:|:|.:|....    |:||:|:.|||:|.:..::...||:::...
  Rat   261 PDLLRGAVFEGCGMTPNANPSQIYNIDPSRFEDLNLAGTAEVGLAGYFMDHAVASRDLPVRMVCA 325

  Fly   237 SRCYRAETSGLQEEKGIYRVHQFNKVEMFAICTE--EQSEAELEEFKNIEVDLFRRLGLNFRLLD 299
            |.||||||...:|..|:||||.|.|||||.:...  |||...||||.:::|::...|||:||:||
  Rat   326 STCYRAETDTGKEPWGLYRVHHFAKVEMFGVTGPGLEQSSQLLEEFLSLQVEILTELGLHFRVLD 390

  Fly   300 MPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIRYRRSADGQILHAHTINGTA 364
            ||..|||.|||:|:|||||||||..:||::|.|||||:|:|||.|.: .:..|::..|||:|.||
  Rat   391 MPTQELGLPAYRKFDIEAWMPGRGRYGEVTSASNCTDFQSRRLYIMF-ETETGELQFAHTVNATA 454

  Fly   365 TAIPRLLIALLESYQKEDG-IEIPAVLRPFMDNQELITRNKRIP 407
            .|:||:|||||||.|::|| :.:||.|:|:: ..:.||....:|
  Rat   455 CAVPRVLIALLESNQQKDGSVLVPAALQPYL-GTDRITAPTHVP 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 149/366 (41%)
class_II_aaRS-like_core 100..394 CDD:294192 131/301 (44%)
Sars2NP_001099710.1 PRK05431 67..493 CDD:235461 163/429 (38%)
Seryl_tRNA_N 67..172 CDD:299883 23/95 (24%)
SerRS_core 185..485 CDD:238393 134/312 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C254554410
eggNOG 1 0.900 E1_COG0172
Hieranoid 1 1.000
Homologene 1 1.000 H6073
Inparanoid 1 1.050 264 1.000 Inparanoid score I2939
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D495094at33208
OrthoFinder 1 1.000 FOG0004395
OrthoInspector 1 1.000 T1087649
orthoMCL 1 0.900 OOG5_126677
Panther 1 1.100 LDO PTHR11778
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.