DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and Sars

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_006233198.1 Gene:Sars RGDID:628813 Length:536 Species:Rattus norvegicus

Alignment Length:416 Identity:122/417 (29%)
Similarity:200/417 (48%) Gaps:54/417 (13%)


  Fly    42 DELERNVVVRHHKNNVPLIRSL----IQELDAGDQHKLRQLQAE-LEQLPNATHPRLRDYGEEPR 101
            |:|..:.:.....:.:..:|.|    ||:.| |::.||...:.| |.::.|..||.:....:|..
  Rat    88 DDLTADTLAALKVSQIKKVRLLVDEAIQKCD-GERVKLEAERFENLREIGNLLHPSVPISNDEDA 151

  Fly   102 ELAQYVHRQLTPQSRLKEFS--ELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQAIIQYALQA 164
            :  ..|.|.....:..|::|  :|...::.:..:......|.:.|:|.|.|..||||:|||||:.
  Rat   152 D--NKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRT 214

  Fly   165 VTEHGFKLISVPDILPKEVIESCGMRTEGERTQVYKL---------DTG---ECLSGTSEMALAG 217
            :...|:..|..|..:.|||::.....::.:. ::||:         |:.   :.|..|||..:|.
  Rat   215 LGSRGYTPIYTPFFMRKEVMQEVAQLSQFDE-ELYKVIGKGSEKSDDSSYDEKYLIATSEQPIAA 278

  Fly   218 FFANKLLSEDQLPLKVTAVSRCYRAET-SGLQEEKGIYRVHQFNKVEMFAICT--EEQSEAELEE 279
            ...::.|..:.||:|....|.|:|.|. |..::.:||:|||||.|:|.|...:  :.:|....:|
  Rat   279 LHRDEWLRPEDLPIKYAGFSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFDE 343

  Fly   280 FKNIEVDLFRRLGLNFRLLDMPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGI 344
            ......:.::.||:.:.::::....|...|.:|.|:|||.||...:.|:.|||||||||||||.|
  Rat   344 MITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRI 408

  Fly   345 RYRRS--------------------------ADGQILHAHTINGTATAIPRLLIALLESYQKEDG 383
            ||.::                          :..::...|.:|.|..|..|.:.|:||:||.|.|
  Rat   409 RYGQTKKMMDKRKNNLRFSTQNKLEAVSSLFSPKKVEFVHMLNATMCATTRTICAILENYQTEKG 473

  Fly   384 IEIPAVLRPFMDN--QELITRNKRIP 407
            |.:|..||.||..  ||||...|..|
  Rat   474 IVVPEKLREFMPPGLQELIPFVKPAP 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 118/394 (30%)
class_II_aaRS-like_core 100..394 CDD:294192 99/337 (29%)
SarsXP_006233198.1 PLN02678 3..510 CDD:215364 122/417 (29%)
Seryl_tRNA_N 3..>72 CDD:280549
SerRS_core 152..484 CDD:238393 99/335 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0172
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D495094at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.