DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and SPAC29A4.15

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_594867.1 Gene:SPAC29A4.15 PomBaseID:SPAC29A4.15 Length:450 Species:Schizosaccharomyces pombe

Alignment Length:428 Identity:120/429 (28%)
Similarity:203/429 (47%) Gaps:40/429 (9%)


  Fly     8 QLWRPLLLLRRQRSHDAKA---VEAPIHRPVPTSAQLDEL--ERNVVVRHHKNNVPLIRSLIQEL 67
            ::::..:.||.:..:..|:   |:..|...:.......||  |:|.:....||       ||::.
pombe    37 EMYKEWVSLRFELDNTNKSINRVQKEIGLKMKAKEDASELLEEKNSLTERKKN-------LIEQE 94

  Fly    68 DAGDQHKLRQLQAELEQLPNATH---PRLRDYGEEPRELAQYVHRQLTPQSRLKE------FSEL 123
            .|    |.:::...:..:.|..|   |...|  |:..|:.    |:..|:....|      ..|:
pombe    95 TA----KNKEMLNVVSSIGNIVHDSVPVSMD--EDNNEII----RKWAPEGVTVEKKNCLSHHEV 149

  Fly   124 ARALNLYRMDHLGNYTGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLISVPDILPKEVIESCG 188
            ...|:.|..:.....:||:.|:|.........|:|||.|..:.:.|:..:..|.:|.|:|:....
pombe   150 LTRLDGYDPERGVKVSGHRGYFLRQYGVFFNLALIQYGLDFLEKRGYIALQAPTMLNKDVMAKTA 214

  Fly   189 MRTEGERTQVYKLDTGE---CLSGTSEMALAGFFANKLLSE--DQLPLKVTAVSRCYRAET-SGL 247
            ...:.:. ::||:..|:   .|..|||..::.:.:.:...:  :|||||....|.|||.|. |..
pombe   215 QLEQFDE-ELYKVIDGDEERYLIATSEQPISAYHSGEWFEKPSEQLPLKYAGYSTCYRREAGSHG 278

  Fly   248 QEEKGIYRVHQFNKVEMFAICTEEQSEAELEEFKNIEVDLFRRLGLNFRLLDMPPCELGAPAYQK 312
            ::..||:|||.|.|:|.|.:...|:|.....|..|...|.::.|.|.:|::.:....|...|.:|
pombe   279 RDAWGIFRVHAFEKIEQFVLTDPEKSWEAFTEMINHAEDFYKSLELPYRIVAIVSGALNNAAAKK 343

  Fly   313 YDIEAWMPGRQMWGEISSCSNCTDYQARRLGIR--YRRSADGQILHAHTINGTATAIPRLLIALL 375
            ||:|||.|.:..:.|:.|||||||||:|.|.||  .::..|.:..:.|.:|.|..|..|.|..:|
pombe   344 YDLEAWFPFQGEYKELVSCSNCTDYQSRNLEIRCGVKKMGDREKKYVHCLNSTLCATERALCCIL 408

  Fly   376 ESYQKEDGIEIPAVLRPFMDNQELITRNKRIPETKLVK 413
            |:||..||:.:|.||:|:|..:..:...|.:|:....|
pombe   409 ENYQTPDGVNVPKVLQPYMGGKTFLPFTKELPKNSTSK 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 106/361 (29%)
class_II_aaRS-like_core 100..394 CDD:294192 96/308 (31%)
SPAC29A4.15NP_594867.1 PLN02678 1..450 CDD:215364 120/429 (28%)
Seryl_tRNA_N 2..112 CDD:280549 16/86 (19%)
SerRS_core 124..427 CDD:238393 96/308 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126677
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.