DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and SPAC25B8.06c

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_594466.2 Gene:SPAC25B8.06c PomBaseID:SPAC25B8.06c Length:479 Species:Schizosaccharomyces pombe

Alignment Length:424 Identity:143/425 (34%)
Similarity:214/425 (50%) Gaps:74/425 (17%)


  Fly    42 DELERNVVVRHHK---NNVPLIRSLIQE-------------------------LDAGDQHKL--- 75
            :.::||.:.|:.:   ..||.|||||.|                         .|..::.||   
pombe    60 EAVQRNCINRNLQAIAETVPKIRSLIDEKESLKNEFFPLLSLKKEITLQIERCSDPNERGKLVNE 124

  Fly    76 -RQLQAELEQ------------------LPNATHPRLRDYGEEPRELAQYVHRQLTPQS-RLKEF 120
             :.|:.:.|:                  :||.|.|.:....|:...:.|.:...|..:: .||:.
pombe   125 AKGLKKKTEEYNKIISKVTNDLYQYCLAVPNTTLPTVPVGPEDKAVVVQKIGSPLVKKTGSLKDH 189

  Fly   121 SELA-RALNLYRMDHLGNYTGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLISVPDILPKEVI 184
            .::| ..:||   :.....:||...|.||.:|.||.||..||:......|:..:..|.|:..::.
pombe   190 LQIANEGINL---EDAAQASGHSFCYTTGDIALLEMAITNYAMDFAISKGWCPVIPPTIVRTDIA 251

  Fly   185 ESCGMRTEGER-TQVYKLDT---------GECLSGTSEMALA--GFFANKLLSEDQLPLKVTAVS 237
            .:||.:...|. .|:|:||:         .:||.||:|::||  ||   |....:....||..||
pombe   252 LACGFQPRDEEGQQIYELDSYTSPLVSSPKQCLIGTAEISLAALGF---KKTFNNFTERKVVGVS 313

  Fly   238 RCYRAETSGL-QEEKGIYRVHQFNKVEMFAICTEEQSEAELEEFKNIEVDLFRRLGLNFRLLDMP 301
            |.||.|.... :|.:|:||:|:|.|||:||.....:|.....|..|.:.:....|.:..|:|:||
pombe   314 RAYRREAGARGKENRGLYRLHEFTKVELFAWTHPSRSSEMFNEIVNFQKEFVETLKIPARILNMP 378

  Fly   302 PCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIRYRRSADGQILHAHTINGTATA 366
            ..|||:.|.||||||||||.||.:|||:|.|||.:||||||..|||...|...:  ||:||||.|
pombe   379 TAELGSSASQKYDIEAWMPARQSYGEITSASNCLEYQARRLLTRYRNDKDSGFV--HTLNGTAAA 441

  Fly   367 IPRLLIALLESYQKEDG-IEIPAVLRPFMDNQEL 399
            ||||:||:||::|:||| :::|..|.|::..:.|
pombe   442 IPRLIIAILENHQQEDGTVKVPETLVPYIHKEYL 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 138/404 (34%)
class_II_aaRS-like_core 100..394 CDD:294192 121/310 (39%)
SPAC25B8.06cNP_594466.2 SerS 49..479 CDD:223250 143/425 (34%)
Seryl_tRNA_N 50..156 CDD:280549 18/96 (19%)
SerRS_core 169..470 CDD:238393 121/309 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6073
Inparanoid 1 1.050 203 1.000 Inparanoid score I969
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004395
OrthoInspector 1 1.000 T1125216
orthoMCL 1 0.900 OOG5_126677
Panther 1 1.100 LDO PTHR11778
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1456
TreeFam 1 0.960
109.950

Return to query results.
Submit another query.