DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and Sars

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_035449.1 Gene:Sars MGIID:102809 Length:536 Species:Mus musculus

Alignment Length:431 Identity:125/432 (29%)
Similarity:203/432 (47%) Gaps:69/432 (16%)


  Fly    35 VPTSA-QLDELERNVVVRHHKNNVPLIRSLIQE-LDAGDQHKLRQLQAE----LEQLPNATHPRL 93
            ||.:. ..|:|..:.:.....:.:..:|.||.| :...|..::: |:||    |.::.|..||.:
Mouse    80 VPENVLNFDDLTADALAALKVSQIKKVRLLIDEAIQKCDGERVK-LEAERFENLREIGNLLHPSV 143

  Fly    94 RDYGEEPRELAQYVHRQLTPQSRLKEFS--ELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQA 156
            ....:|..:  ..|.|.....:..|::|  :|...::.:..:......|.:.|:|.|.|..||||
Mouse   144 PISNDEDAD--NKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGPLVFLEQA 206

  Fly   157 IIQYALQAVTEHGFKLISVPDILPKEVIESCGMRTEGERTQVYKL---------DTG---ECLSG 209
            :|||||:.:...|:..|..|..:.|||::.....::.:. ::||:         |..   :.|..
Mouse   207 LIQYALRTLGSRGYTPIYTPFFMRKEVMQEVAQLSQFDE-ELYKVIGKGSEKSDDNSYDEKYLIA 270

  Fly   210 TSEMALAGFFANKLLSEDQLPLKVTAVSRCYRAET-SGLQEEKGIYRVHQFNKVEMFAICTEEQS 273
            |||..:|....::.|..:.||:|...:|.|:|.|. |..::.:||:|||||.|:|.|...:...:
Mouse   271 TSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDN 335

  Fly   274 E---------AELEEFKNIEVDLFRRLGLNFRLLDMPPCELGAPAYQKYDIEAWMPGRQMWGEIS 329
            :         |..|||       ::.||:.:.::::....|...|.:|.|:|||.||...:.|:.
Mouse   336 KSWEMFDEMIATAEEF-------YQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELV 393

  Fly   330 SCSNCTDYQARRLGIRYRRS--------------------------ADGQILHAHTINGTATAIP 368
            |||||||||||||.|||.::                          :..::...|.:|.|..|..
Mouse   394 SCSNCTDYQARRLRIRYGQTKKMMDKKKNNLRFSTQNKLKAMSSLFSPKKVEFVHMLNATMCATT 458

  Fly   369 RLLIALLESYQKEDGIEIPAVLRPFMDN--QELITRNKRIP 407
            |.:.|:||:||.|.||.:|..||.||..  ||||...|..|
Mouse   459 RTICAILENYQAEKGIAVPEKLREFMPPGLQELIPFVKPAP 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 119/401 (30%)
class_II_aaRS-like_core 100..394 CDD:294192 101/344 (29%)
SarsNP_035449.1 PLN02678 3..510 CDD:215364 125/432 (29%)
Seryl_tRNA_N 3..109 CDD:280549 5/29 (17%)
SerRS_core 152..484 CDD:238393 101/342 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0172
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S479
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126677
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.750

Return to query results.
Submit another query.