DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and sars-1

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_501804.1 Gene:sars-1 WormBaseID:WBGene00005663 Length:487 Species:Caenorhabditis elegans

Alignment Length:446 Identity:129/447 (29%)
Similarity:211/447 (47%) Gaps:71/447 (16%)


  Fly    16 LRRQRSHDAKAVEAPIHRPVP---------------TSAQLDELERNVVVRHHKNNVPLIRSLIQ 65
            |.||::..:||:...:.:..|               ...::|||.:..||:..|     :|.|:.
 Worm    53 LNRQKNAISKAIGEKMKKKEPQGTDDSVADDIVARLAELKIDELSQLTVVQLKK-----LRVLVD 112

  Fly    66 ELDAGDQHKLRQLQAELEQLPNATHPRLRDYGE--------EPRELAQYVHRQLTPQSRLKEFSE 122
            |       |..|..|.:....||.|.:|...|.        ...|....:.|.....|..|::|.
 Worm   113 E-------KSVQTAAAVIANENARHEKLIQIGNLIHSSVVVSKDEANNKIERTFGDLSTKKKYSH 170

  Fly   123 LARALNLYRMD-HLGN-YTGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLISVPDILPKEVIE 185
            :...:.:...| ..|. ..|.:.|:|.|.|..|||||||.|||.:...|:..:..|..:.|||::
 Worm   171 VDLVVMVDGFDGERGTVVAGGRGYFLKGPLVFLEQAIIQLALQRLNVKGYVPLYTPFFMRKEVMQ 235

  Fly   186 SCGMRTEGERTQVYKL---------DTG---ECLSGTSEMALAGFFANKLLSEDQLPLKVTAVSR 238
            .....::.: .::||:         ||.   :.|..|||..:|.:..|:.:.|.:||:|...||.
 Worm   236 EVAQLSQFD-DELYKVSSKGSEIAGDTSVDEKYLIATSEQPIAAYHRNEWIKETELPIKYAGVST 299

  Fly   239 CYRAET-SGLQEEKGIYRVHQFNKVEMFAICTEEQSEAEL---EEFKNIEVDLFRRLGLNFRLLD 299
            |:|.|. |..::.:||:|||||.|:|.|.:|:...:|:..   |...|.| ..::.|.:.:::::
 Worm   300 CFRQEVGSHGRDTRGIFRVHQFEKIEQFVLCSPNDNESWTLFDEMIGNAE-SYYQELQIPYQVVN 363

  Fly   300 MPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIRY--RRSADGQILHAHTING 362
            :...||...|.:|:|:|||.||...:.|:.|||||.|||:|||.:||  .:...|::...|.:|.
 Worm   364 IVSGELNNAAAKKFDLEAWFPGSGAYRELVSCSNCLDYQSRRLKVRYGQTKKLSGEVPFVHMLNA 428

  Fly   363 TATAIPRLLIALLESYQKEDGIEIPAVLRPFMDNQELITRNKRIPET--KLVKFIK 416
            |..|..|::.|:||:.|.|:||.:|..::.:|            ||.  ..:.|:|
 Worm   429 TMCATTRVICAILENNQTEEGINVPTAIQQWM------------PENYRTFIPFVK 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 113/372 (30%)
class_II_aaRS-like_core 100..394 CDD:294192 101/314 (32%)
sars-1NP_501804.1 PLN02678 3..486 CDD:215364 129/447 (29%)
Seryl_tRNA_N 3..110 CDD:280549 13/62 (21%)
SerRS_core 152..460 CDD:238393 100/310 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S479
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D495094at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126677
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.