DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and sars-2

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_500549.1 Gene:sars-2 WormBaseID:WBGene00005662 Length:441 Species:Caenorhabditis elegans

Alignment Length:418 Identity:152/419 (36%)
Similarity:234/419 (56%) Gaps:59/419 (14%)


  Fly    17 RRQRSHDAKAVE-----APIHRP------VPTSAQLDELERNVVVRHHKNNVPLIR---SLIQEL 67
            ||..|.:|...|     .|:.||      :.....|:.:..|::.|....::..:.   ::||::
 Worm    21 RRFTSSEASTSEESSSAPPVMRPDLNFEFLLDEKNLEAIRENILNRKGVGDIDKVHKKWAVIQKM 85

  Fly    68 ---------DAGDQHKLRQLQAELEQ----LPNATH---PR--------LRDYGEEPRELAQYVH 108
                     .|..:.|.:||..||..    :||.|.   ||        :.::||:..:      
 Worm    86 MKSGEKQTNGAVSEQKYKQLWDELYDEAILIPNMTQDGVPRGSEDQAKIVAEWGEKRED------ 144

  Fly   109 RQLTPQSRLKEFSELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLI 173
            ..||.:..::.:..|.         |..:.:|.:||...|.||:||:|::.||.:.|...||:.|
 Worm   145 ECLTAEKLVQTWRSLL---------HPTDASGQRSYVFLGALASLEKALLDYAHERVCALGFRPI 200

  Fly   174 SVPDILPKEVIESCGMRTEGERTQVYKLDTGEC---LSGTSEMALAGFFANKLLSEDQLPLKVTA 235
            :||||:..||.::||:....:....|.|...|.   ||||:||.:|.|...:..::||||:::.:
 Worm   201 TVPDIVSGEVTQACGVMQRSDHPIQYTLAGEESHTKLSGTAEMGIAAFLRGRTFNQDQLPIRLVS 265

  Fly   236 VSRCYRAETSGLQEEKGIYRVHQFNKVEMFAICTEEQSEAELEEFKNIEVDLFRRLGLNFRLLDM 300
            :|||:|.|.|....|..:||||:|:|||||.:.|.|||.|||:....::...|:.||::.|.|:|
 Worm   266 LSRCFRTEISKSASEAKLYRVHEFSKVEMFVVSTPEQSAAELDYLVEVQKGTFQALGVHCRQLEM 330

  Fly   301 PPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIRYRRSADGQILHAHTINGTAT 365
            |..||||.|.:|:|||||||||:::||:||.|||||:|:|||||:| ::|||...:|||.||||.
 Worm   331 PSEELGASAARKFDIEAWMPGRKLYGEVSSASNCTDFQSRRLGIKY-KTADGTTKYAHTCNGTAL 394

  Fly   366 AIPRLLIALLESYQKE-DGI-EIPAVLR 391
            |..|.||::||::|.: .|: |:|..||
 Worm   395 ASTRALISVLETFQNDKKGLGELPEPLR 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 141/365 (39%)
class_II_aaRS-like_core 100..394 CDD:294192 126/298 (42%)
sars-2NP_500549.1 SerS 45..423 CDD:223250 144/395 (36%)
class_II_aaRS-like_core 131..423 CDD:294192 128/309 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C254539422
eggNOG 1 0.900 E1_COG0172
Hieranoid 1 1.000
Homologene 1 1.000 H6073
Inparanoid 1 1.050 235 1.000 Inparanoid score I2122
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D495094at33208
OrthoFinder 1 1.000 FOG0004395
OrthoInspector 1 1.000 T475195
orthoMCL 1 0.900 OOG5_126677
Panther 1 1.100 LDO PTHR11778
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1456
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.