DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and FBXO17

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_680474.1 Gene:FBXO17 HGNCID:18754 Length:287 Species:Homo sapiens

Alignment Length:61 Identity:19/62 (31%)
Similarity:30/62 (48%) Gaps:6/62 (10%)


  Fly     4 PTNSQLWRPLLLLRRQRSHDAKAVEAPIHRPVPTSAQLDELERNVVVRHHKNNVPLIRSLI 64
            ||   :|  ||.|.|.||.:.:|:.|...|.:|::...:|.....:.|:.. ..|..|:||
Human    65 PT---VW--LLQLARDRSAEGRALYAVAQRCLPSNEDKEEFPLCALARYCL-RAPFGRNLI 119

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 3/6 (50%)
class_II_aaRS-like_core 100..394 CDD:294192
FBXO17NP_680474.1 F-box-like 27..68 CDD:289689 2/6 (33%)
FBA 110..282 CDD:282196 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C254554108
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.