DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SerRS-m and sars2

Sequence 1:NP_001262599.1 Gene:SerRS-m FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_002940400.1 Gene:sars2 XenbaseID:XB-GENE-969286 Length:505 Species:Xenopus tropicalis

Alignment Length:417 Identity:166/418 (40%)
Similarity:242/418 (58%) Gaps:49/418 (12%)


  Fly    16 LRRQRSHDAKAVEAPIHRPVPTSAQ-LDELERNVVVRHHKNNVPL-IRSLIQELDAGDQHKLRQL 78
            |..::|..||.|:   |..:....| |....|..::|....::.| :.:|.:|            
 Frog    97 LEEEKSAIAKEVK---HMVISEEKQNLQTNPRYALIRKRGKDIRLELSTLYKE------------ 146

  Fly    79 QAELE--------QLPNATHPRLRDYGEEPRELAQYVHRQLTPQSRLKEFS-------ELARALN 128
            ::.||        :|||.|||. ...|:|.:.      |.|.......||.       |:...|:
 Frog   147 ESNLEGSFYPRALRLPNRTHPN-TPVGDESKA------RVLEVVGVKPEFDFKICGHLEIGEDLD 204

  Fly   129 LYRMDHLGNYTGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLISVPDILPKEVIESCGMRTEG 193
            :.|...|.:.:||:||||.|..:.|:.|::.:.:..:.:.||..:||||:|...|.|.|||:.:.
 Frog   205 IIRQRRLSHVSGHRSYYLRGAGSLLQHALVNFTISKLVKKGFIPMSVPDMLRGAVFEGCGMQADA 269

  Fly   194 ERTQVYKLDTGE----CLSGTSEMALAGFFANKLLSEDQLPLKVTAVSRCYRAETSGLQEEKGIY 254
            ..:|||.:|..:    .|:||||:.:||||.:..:....||::....|.||||||...:|..|:|
 Frog   270 HASQVYSVDPLQHPDLNLAGTSEVGIAGFFMDHAVMLQDLPVRTVCCSTCYRAETDTGRETWGLY 334

  Fly   255 RVHQFNKVEMFAICTEE---QSEAELEEFKNIEVDLFRRLGLNFRLLDMPPCELGAPAYQKYDIE 316
            |||.|.|||||.:...|   :|:..|:||..::.::|..|||:|::|:||..|||.|||:|||||
 Frog   335 RVHHFTKVEMFGVTANESGIESQEMLDEFLGLQKEIFSELGLHFKVLEMPTQELGLPAYRKYDIE 399

  Fly   317 AWMPGRQMWGEISSCSNCTDYQARRLGIRYRRSADGQILHAHTINGTATAIPRLLIALLESYQKE 381
            ||||||..:|||||.|||||||:|||.|.|:|. ||::.||||:||||.|:||||||:|||.|::
 Frog   400 AWMPGRGKYGEISSTSNCTDYQSRRLNIMYQRQ-DGELRHAHTVNGTACAVPRLLIAILESNQRK 463

  Fly   382 DG-IEIPAVLRPFMDNQELITRNKRIP 407
            || :.||.||:|:| ..::|.:.:.||
 Frog   464 DGAVLIPEVLQPYM-GTDVIEKPRYIP 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 153/367 (42%)
class_II_aaRS-like_core 100..394 CDD:294192 139/309 (45%)
sars2XP_002940400.1 PRK05431 49..485 CDD:235461 164/412 (40%)
SerRS_core 177..477 CDD:238393 139/307 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C254550828
eggNOG 1 0.900 E1_COG0172
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6073
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D495094at33208
OrthoFinder 1 1.000 FOG0004395
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.800

Return to query results.
Submit another query.