DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL9 and RPL9

DIOPT Version :9

Sequence 1:NP_524363.3 Gene:mRpL9 / 41859 FlyBaseID:FBgn0038319 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_190075.1 Gene:RPL9 / 823623 AraportID:AT3G44890 Length:197 Species:Arabidopsis thaliana


Alignment Length:177 Identity:45/177 - (25%)
Similarity:74/177 - (41%) Gaps:33/177 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RMRAKNFIYELVDDTLVKKRPNIEVVLKTFVEGVGDKGDVVSMKPHFVYNKLLLPGLAAYNTP-- 108
            ::..:.|.:|:|.....||..  :|:||..|..:|.:|.::.:|..|..|.||..|.|...||  
plant    30 KVSERRFNFEVVSQKKAKKLR--KVILKEDVTDLGKQGQLLDVKAGFFRNFLLPTGKAQLMTPLL 92

  Fly   109 --ENVAKYAKTEAEKSTVKHSSPYAQRTVNMLETI--------------VLAVVMNKDEPWVLEP 157
              |...:..:.||||..||..   ||:...:.:|:              :...|..:|...:   
plant    93 LKELKMEDERIEAEKQRVKEE---AQQLAMVFQTVGAFKVKRKGGKGKLIFGSVTAQDLVDI--- 151

  Fly   158 WHIKASLRKTGFYCREECITLPKERIEGPDLK--KENKDFYCTVTIN 202
              ||:.|:|.   ..:..::||:.|..|..:.  |.:.|....|.||
plant   152 --IKSQLQKD---IDKRLVSLPEIRETGEYIAELKLHPDVTARVKIN 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL9NP_524363.3 Ribosomal_L9_N 69..114 CDD:279605 16/48 (33%)
RPL9NP_190075.1 rplI 51..194 CDD:234659 40/154 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0359
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005447
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21368
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.