DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL9 and Mrpl9

DIOPT Version :9

Sequence 1:NP_524363.3 Gene:mRpL9 / 41859 FlyBaseID:FBgn0038319 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_084392.1 Gene:Mrpl9 / 78523 MGIID:2137211 Length:265 Species:Mus musculus


Alignment Length:220 Identity:62/220 - (28%)
Similarity:106/220 - (48%) Gaps:25/220 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RTTFVLKRKYDPPLHKTNEKPRRMRAKNFIYELVDDTLVKKRPNIEVVLKTFVEGVGDKGDVVSM 88
            ::|.:::|.:..||.....|| .:..::.:|:||:||..:.:.|:|::|...|:.:|.:||:||:
Mouse    48 QSTVIVERWWKVPLAGEGRKP-HLHRRHRVYKLVEDTKHRPKDNLELILTQSVDEIGVRGDLVSV 111

  Fly    89 KPHFVYNKLLLPGLAAYNTPENVAKYAKTEAEKS------TVKHSSPYAQRTVNMLETIVLAVVM 147
            |.....||||..|||.|.:|||...:   |.|||      ..|..:...:.||..|.:..|.|.|
Mouse   112 KKSVGRNKLLSQGLAVYASPENRKLF---EEEKSLRREGKLEKIQTKAGEATVKFLRSCHLEVGM 173

  Fly   148 NKDEPWVLEPWHI-KASLRKTGFYCREECITLPKERIE--GPDLKKENKDFYCTVTINKLEQARL 209
            ..:..|.|.|..: :...:..|.......:.||:|.|.  |        :::|.||:|.|:..|:
Mouse   174 KNNVKWELNPEIVARHFFKNLGVVVAPHALRLPEEPITRWG--------EYWCDVTVNGLDTVRV 230

  Fly   210 KCRLHHWSTDPSERLPYVLEHWKLQ 234
            ...:..:....::|    .:||..|
Mouse   231 PMSVVLFQKPKTKR----YKHWLAQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL9NP_524363.3 Ribosomal_L9_N 69..114 CDD:279605 20/44 (45%)
Mrpl9NP_084392.1 rplI 92..222 CDD:234659 42/140 (30%)
Ribosomal_L9_N 92..137 CDD:279605 20/44 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834717
Domainoid 1 1.000 41 1.000 Domainoid score I12475
eggNOG 1 0.900 - - E1_COG0359
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12696
Inparanoid 1 1.050 80 1.000 Inparanoid score I5197
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46719
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005447
OrthoInspector 1 1.000 - - oto94559
orthoMCL 1 0.900 - - OOG6_110160
Panther 1 1.100 - - LDO PTHR21368
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4174
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.