DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL9 and Mrpl9

Sequence 1:NP_524363.3 Gene:mRpL9 FlyBaseID:FBgn0038319 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_084392.1 Gene:Mrpl9 MGIID:2137211 Length:265 Species:Mus musculus

Alignment Length:220 Identity:62/221 (28%)
Similarity:106/221 (48%) Gaps:25/221 (11%)


  Fly    24 RTTFVLKRKYDPPLHKTNEKPRRMRAKNFIYELVDDTLVKKRPNIEVVLKTFVEGVGDKGDVVSM 88
            ::|.:::|.:..||.....|| .:..::.:|:||:||..:.:.|:|::|...|:.:|.:||:||:
Mouse    48 QSTVIVERWWKVPLAGEGRKP-HLHRRHRVYKLVEDTKHRPKDNLELILTQSVDEIGVRGDLVSV 111

  Fly    89 KPHFVYNKLLLPGLAAYNTPENVAKYAKTEAEKS------TVKHSSPYAQRTVNMLETIVLAVVM 147
            |.....||||..|||.|.:|||...:   |.|||      ..|..:...:.||..|.:..|.|.|
Mouse   112 KKSVGRNKLLSQGLAVYASPENRKLF---EEEKSLRREGKLEKIQTKAGEATVKFLRSCHLEVGM 173

  Fly   148 NKDEPWVLEPWHI-KASLRKTGFYCREECITLPKERIE--GPDLKKENKDFYCTVTINKLEQARL 209
            ..:..|.|.|..: :...:..|.......:.||:|.|.  |        :::|.||:|.|:..|:
Mouse   174 KNNVKWELNPEIVARHFFKNLGVVVAPHALRLPEEPITRWG--------EYWCDVTVNGLDTVRV 230

  Fly   210 KCRLHHWSTDPSERLPYVLEHWKLQ 234
            ...:..:....::|    .:||..|
Mouse   231 PMSVVLFQKPKTKR----YKHWLAQ 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL9NP_524363.3 Ribosomal_L9_N 69..114 CDD:279605 20/45 (44%)
Mrpl9NP_084392.1 rplI 92..222 CDD:234659 43/141 (30%)
Ribosomal_L9_N 92..137 CDD:279605 20/45 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C174639532
eggNOG 1 0.900 E1_COG0359
Hieranoid 1 1.000
Homologene 1 1.000 H12696
Inparanoid 1 1.050 81 1.000 Inparanoid score I5158
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006279
OrthoInspector 1 1.000 T1084106
orthoMCL 1 0.900 OOG5_133711
Panther 1 1.100 LDO PTHR21368
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4174
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.