DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL9 and MRPL9

Sequence 1:NP_524363.3 Gene:mRpL9 FlyBaseID:FBgn0038319 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_113608.1 Gene:MRPL9 HGNCID:14277 Length:267 Species:Homo sapiens

Alignment Length:234 Identity:67/235 (29%)
Similarity:114/235 (49%) Gaps:19/235 (8%)


  Fly    18 SLQQQVRTTFVLKRKYDPPLHKTNEKPRRMRAKNFIYELVDDTLVKKRPNIEVVLKTFVEGVGDK 82
            ||.|. |.|.:::|.:..||.....|| |:..::.:|:||:||..:.:.|:|::|...||.||.:
Human    46 SLSQN-RGTVIVERWWKVPLAGEGRKP-RLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGVR 108

  Fly    83 GDVVSMKPHFVYNKLLLPGLAAYNTPENVAKYAKTE---AEKSTVKHSSPYAQRTVNMLETIVLA 144
            ||:||:|.....|:||..|||.|.:|||...:.:.:   .|....|..:...:.||..|::..|.
Human   109 GDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKIQTKAGEATVKFLKSCRLE 173

  Fly   145 VVMNKDEPWVLEPWHI-KASLRKTGFYCREECITLPKERIE--GPDLKKENKDFYCTVTINKLEQ 206
            |.|..:..|.|.|..: :...:..|.......:.||:|.|.  |        :::|.||:|.|:.
Human   174 VGMKNNVKWELNPEIVARHFFKNLGVVVAPHTLKLPEEPITRWG--------EYWCEVTVNGLDT 230

  Fly   207 ARLKCRLHHWSTDPSERLPYVLEHWKLQSEPLLDVCSPE 245
            .|:...:.::....::|..|.|..   |:...:...||:
Human   231 VRVPMSVVNFEKPKTKRYKYWLAQ---QAAKAMAPTSPQ 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL9NP_524363.3 Ribosomal_L9_N 69..114 CDD:279605 21/45 (47%)
MRPL9NP_113608.1 Ribosomal_L9_C 91..219 CDD:332034 39/136 (29%)
Ribosomal_L9_N 95..140 CDD:307445 21/45 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C174638424
eggNOG 1 0.900 E1_COG0359
Hieranoid 1 1.000
Homologene 1 1.000 H12696
Inparanoid 1 1.050 86 1.000 Inparanoid score I5083
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1036760at2759
OrthoFinder 1 1.000 FOG0006279
OrthoInspector 1 1.000 T1074013
orthoMCL 1 0.900 OOG5_133711
Panther 1 1.100 LDO PTHR21368
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4174
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.