DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL9 and mrpl9

Sequence 1:NP_524363.3 Gene:mRpL9 FlyBaseID:FBgn0038319 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001093514.2 Gene:mrpl9 ZFINID:ZDB-GENE-070717-4 Length:248 Species:Danio rerio

Alignment Length:240 Identity:64/241 (27%)
Similarity:102/241 (42%) Gaps:53/241 (22%)


  Fly    11 NLLKSATSLQQQVRT----TFVLKRKYDPPLHKTNEKPRRMRAKNFIYELVDDTLVKKRPNIEVV 71
            ||..|.:.:|...:|    |.:::|.:..||.|..:.||....::.:|.||:|.....:..:|::
Zfish    19 NLRSSLSRVQNLSQTACKNTVIVERCWKVPLSKEGKPPRLHPRRHKVYRLVEDKKNSPQDKMELI 83

  Fly    72 LKTFVEGVGDKGDVVSMKPHFVYNKLLLPGLAAYNTPENVAKYAKTEAEKSTVKHSSP------- 129
            |...|..:|.:||.|.:|.....||||..|||.|.:.:|...:|:   |...:....|       
Zfish    84 LTQTVPKLGGRGDTVFVKKAVGRNKLLPEGLAVYPSQDNKDMFAE---ELKKLHEGDPEDRIQTR 145

  Fly   130 YAQRTVNMLETIVLAVVMNKDEPWVLEPWH------------IKASLRKTGFYCREECITLPKER 182
            ..|:||..|:...|.|           |:|            .:..|||.|.......:|||:|.
Zfish   146 TGQQTVEFLKNTELKV-----------PFHTSIQYSLTKEIVCRQFLRKRGVVVPPHALTLPEEP 199

  Fly   183 IEGPDLKKENKDFYCTVTINKLEQARLKCRLHHWSTDPSERLPYV 227
            |.||.      :.:|.||:|.|::.|:          |...:|:|
Zfish   200 ITGPG------EHWCEVTVNGLDRVRV----------PMSVVPFV 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL9NP_524363.3 Ribosomal_L9_N 69..114 CDD:279605 17/45 (38%)
mrpl9NP_001093514.2 rplI 80..212 CDD:234659 42/152 (28%)
Ribosomal_L9_N 81..126 CDD:279605 17/45 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C174638863
eggNOG 1 0.900 E1_COG0359
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H12696
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1036760at2759
OrthoFinder 1 1.000 FOG0006279
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133711
Panther 1 1.100 LDO PTHR21368
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.