DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL9 and mrpl9

Sequence 1:NP_524363.3 Gene:mRpL9 FlyBaseID:FBgn0038319 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001007697.1 Gene:mrpl9 RGDID:1359171 Length:262 Species:Rattus norvegicus

Alignment Length:228 Identity:61/229 (27%)
Similarity:110/229 (48%) Gaps:21/229 (9%)


  Fly    24 RTTFVLKRKYDPPLHKTNEKPRRMRAKNFIYELVDDTLVKKRPNIEVVLKTFVEGVGDKGDVVSM 88
            ::|.:::|.:..||.....|| |:..::.:|:||:||..:.:.::|::|...|:.:|.:||:||:
  Rat    48 QSTVIVERWWKVPLAGEGRKP-RLHRRHRVYKLVEDTKHRPKDHLELILTQSVDEIGVRGDLVSV 111

  Fly    89 KPHFVYNKLLLPGLAAYNTPENVAKYAKTE---AEKSTVKHSSPYAQRTVNMLETIVLAVVMNKD 150
            |.....||||..|||.|.:|||...:.:.:   .|....|..:...:.||..|.:..|.|.|..:
  Rat   112 KKSVGRNKLLPQGLAVYASPENRKLFEEEKLLRQEGKLEKIQTKAGEATVKFLRSCRLEVGMKNN 176

  Fly   151 EPWVLEPWHI-KASLRKTGFYCREECITLPKERIE--GPDLKKENKDFYCTVTINKLEQARLKCR 212
            ..|.|.|..: :...:..|.......:.||::.|.  |        :::|.||:|.|:..|:...
  Rat   177 VKWELNPEIVARHFFKNLGVVVAPHALRLPEDPITRWG--------EYWCDVTVNGLDTVRVPMS 233

  Fly   213 LHHWSTDPSERLPYVLEHWKLQSEPLLDVCSPE 245
            :..:....::|    .:||..|.  ...:.|||
  Rat   234 VVLFRKPKTKR----YKHWLAQQ--AAKITSPE 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL9NP_524363.3 Ribosomal_L9_N 69..114 CDD:279605 20/45 (44%)
mrpl9NP_001007697.1 rpl9 88..223 CDD:214378 39/143 (27%)
Ribosomal_L9_N 92..137 CDD:279605 20/45 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C174638996
eggNOG 1 0.900 E1_COG0359
Hieranoid 1 1.000
Homologene 1 1.000 H12696
Inparanoid 1 1.050 79 1.000 Inparanoid score I5064
OMA 1 1.010
OrthoDB 1 1.010 D1036760at2759
OrthoFinder 1 1.000 FOG0006279
OrthoInspector 1 1.000 T1087657
orthoMCL 1 0.900 OOG5_133711
Panther 1 1.100 LDO PTHR21368
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.