DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL9 and SPCC777.17c

Sequence 1:NP_524363.3 Gene:mRpL9 FlyBaseID:FBgn0038319 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_588259.1 Gene:SPCC777.17c PomBaseID:SPCC777.17c Length:101 Species:Schizosaccharomyces pombe

Alignment Length:73 Identity:19/74 (26%)
Similarity:31/74 (42%) Gaps:14/74 (19%)


  Fly    65 RPNIEVVLKTFVEGVGDKGDVVSMKPHFVYNKLLLPGLAAYNTPENVAKYAKTEAEKSTVKH--- 126
            :|.:..:|...|..:|.:|||||:...:..|.|.         |:..|  ...:|.||...|   
pombe    38 KPFLVKLLNNEVSKLGRQGDVVSVTRGYYRNTLF---------PKKQA--IAVDALKSMKAHLLQ 91

  Fly   127 SSPYAQRT 134
            .|.::.:|
pombe    92 GSEFSTKT 99

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL9NP_524363.3 Ribosomal_L9_N 69..114 CDD:279605 12/45 (27%)
SPCC777.17cNP_588259.1 RplI 1..>101 CDD:223436 19/74 (26%)
Ribosomal_L9_N 44..>77 CDD:279605 12/44 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006279
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21368
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.