DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL9 and mrpl-9

Sequence 1:NP_524363.3 Gene:mRpL9 FlyBaseID:FBgn0038319 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_492810.2 Gene:mrpl-9 WormBaseID:WBGene00015025 Length:276 Species:Caenorhabditis elegans

Alignment Length:212 Identity:63/213 (30%)
Similarity:102/213 (48%) Gaps:8/213 (4%)


  Fly    20 QQQVRTTFVLKRKYDP---PLHKTNEKPRRMRAKNFIYELVDDTLVKKRPNIEVVLKTFVEGVGD 81
            :|..|.|:||:|.:.|   |.....:.|....... .||:|:....|....|.|:|...|||:|.
 Worm    16 RQASRNTWVLRRVFQPEVTPPGGVQKNPNDFHDYQ-KYEVVEFETQKSAGPINVILLQDVEGIGH 79

  Fly    82 KGDVVSMKPHFVYNKLLLPGLAAYNTPENVAKYA--KTE-AEKSTVKHSSPYAQRTVNM-LETIV 142
            :.||||:........|||...|.|.:|.::..|:  ||. ||:...:...||..:.|.. |:.:|
 Worm    80 QFDVVSVDRTLARKDLLLSKKAVYASPFDLKYYSDMKTRMAEELASRIRIPYELKVVGRDLQKMV 144

  Fly   143 LAVVMNKDEPWVLEPWHIKASLRKTGFYCREECITLPKERIEGPDLKKENKDFYCTVTINKLEQA 207
            :.:.:|.:..|.::...:|:|||:.|.:..|..|.|..:.|.||:...|.|.|...|.:|:....
 Worm   145 IPIKVNMENQWTIDRNLVKSSLRQMGVFVAENTIFLAAKPISGPNFDIEAKLFRFYVVVNQQYIV 209

  Fly   208 RLKCRLHHWSTDPSERL 224
            .:..|:.|.|.|.|:::
 Worm   210 PMLGRITHISVDESKQM 226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL9NP_524363.3 Ribosomal_L9_N 69..114 CDD:279605 16/45 (36%)
mrpl-9NP_492810.2 Ribosomal_L9_N 68..112 CDD:279605 16/44 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C174635641
eggNOG 1 0.900 E1_COG0359
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I3797
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1036760at2759
OrthoFinder 1 1.000 FOG0006279
OrthoInspector 1 1.000 T474026
orthoMCL 1 0.900 OOG5_133711
Panther 1 1.100 LDO PTHR21368
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4174
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.