| Sequence 1: | NP_524362.2 | Gene: | ea / 41858 | FlyBaseID: | FBgn0000533 | Length: | 392 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001070924.1 | Gene: | zgc:153968 / 768292 | ZFINID: | ZDB-GENE-061027-211 | Length: | 301 | Species: | Danio rerio | 
| Alignment Length: | 293 | Identity: | 87/293 - (29%) | 
|---|---|---|---|
| Similarity: | 127/293 - (43%) | Gaps: | 56/293 - (19%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   110 SNSLLPLPGQCGNI-LSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASH 173 
  Fly   174 CVNGKALPTDWRLSG----VRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPAS 234 
  Fly   235 KNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTE------QLSASNL 293 
  Fly   294 KLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDS-CRGDSGGPLIGLDTNKVNTYYFLA 357 
  Fly   358 GVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| ea | NP_524362.2 | CLIP | 37..89 | CDD:288855 | |
| Tryp_SPc | 127..386 | CDD:214473 | 77/269 (29%) | ||
| Tryp_SPc | 128..389 | CDD:238113 | 78/271 (29%) | ||
| zgc:153968 | NP_001070924.1 | Tryp_SPc | 35..262 | CDD:214473 | 77/269 (29%) | 
| Tryp_SPc | 36..265 | CDD:238113 | 78/271 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170587394 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X11 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.840 | |||||