DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ea and zgc:153968

Sequence 1:NP_524362.2 Gene:ea FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio

Alignment Length:293 Identity:87/294 (30%)
Similarity:127/294 (43%) Gaps:56/294 (19%)


  Fly   110 SNSLLPLPGQCGNI-LSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASH 173
            |.||..| ..||.. |..||.||.......:||...|.|..:.|..   |||:||:..:|::|:.
Zfish    18 SGSLCQL-DVCGRAPLKPRIIGGQTAMAGSWPWQVSIHYIPTGGLL---CGGTLINREWVLSAAQ 78

  Fly   174 CVNGKALPTDWRLSG----VRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPAS 234
            |..        :|:.    |.||...|..               |..:..|..:.|.||.|..|:
Zfish    79 CFQ--------KLTASNLVVHLGHLSTGD---------------PNVIHNPASQIINHPKYDSAT 120

  Fly   235 KNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTE------QLSASNL 293
            ..  ||||||:|:..|.:||:::|:||...   .|:...|....:.|||...      ..:...:
Zfish   121 NK--NDIALLKLSTPVSFTDYIKPVCLTAS---GSSLGKGAVSWITGWGSINTGGTQFPTTLQEV 180

  Fly   294 KLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDS-CRGDSGGPLIGLDTNKVNTYYFLA 357
            |:.....|    :|::.|.|   |:.|..:|||..||... |.||.||||:    :..:..:..:
Zfish   181 KIPVVSNG----DCKSAYGS---LITDGMICAGPNEGGKGICMGDGGGPLV----HNSSEQWIQS 234

  Fly   358 GVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            |:.||| ..|.....|||:|.|.:|..||::.|
Zfish   235 GIASFG-RGCAQPKNPGVFTRVSEYESWIKSQI 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 78/270 (29%)
Tryp_SPc 128..389 CDD:238113 78/272 (29%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 78/270 (29%)
Tryp_SPc 36..265 CDD:238113 78/272 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C98757026
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.